SecReT6
Protein ID: 558666125
SecReT6 ID870
T6SS typei4a
Gene symbol-
Locus tagPA1R_gp0163
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]196089..197381 [-]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDU6AMP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.00E-69, Aligned region: 7..398
Protein Sequence: 430 a.a.     [Download]
>gi|558666125|ref|YP_008802835.1| Uncharacterized protein ImpJ/VasE [Pseudomonas aeruginosa PA1R]
MQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAILPDGLPVSVQAGVD
APLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEHPEPITVWRASLRL
VGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRVQSLCARAREKALFLGGRLRLAQQA
GNQDDAVEIRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGVPAFEALDFLDLRR
GYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGEQAAADWLERAIVA
SDPHLPLLARQRMSGLPRQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVAPVSGVASSPWQIV
LFVADGSDNT
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c197381-196089 Pseudomonas aeruginosa PA1R, complete genome
ATGCAACTGCTTCCCCAGCATTTCCAGTTGCAGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGAC
AGGCCTGCAACCCTTGGTTCTGGGGAGTGACCGCCCTGGAACTGGACCCCTCTGCGTTGTGCGCCGGCCA
AGTGCGGGTCCTGCACCTCGAAGCGATCCTGCCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGAC
GCGCCGCTGGAGTTCGATCTGGAGACAGCGCTGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGG
CGGTCAGTCCGCTGTGGCGGGCGGGTCAGTTGCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGC
GCCGCTGCCGGACCTGGCCAGCGGCGAGCACCCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTG
GTCGGCGACGACGGCAAGGCCGACTCCGTGTGCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCT
ACGTCAGCCTGCCCTACGTCCCGCCGACGCCACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCGTGCA
GTCGCTCTGCGCGCGGGCCCGGGAGAAGGCGCTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCG
GGCAACCAGGACGACGCGGTGGAAATCCGTCGCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCG
AAGGCCTGCTGGCAAGCCGTGCGGCCTCGCCGCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGTGC
CTGGGCGGCGCTCGATCCGCTGGCCGGCGTGCCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGT
GGCTACGAGCCGCTGCTGGACTGGTTGGAGCGCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGC
CGTTCGAGCAGGAGGAACAGGTATTTTCCGTGCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGT
CGGCCTGCGGATGCCCGCCGGCGCCGGCGAACAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCC
TCCGACCCGCACCTGCCGTTGCTCGCCCGGCAACGCATGAGCGGGCTGCCGCGGCAGCCGATGAATCGCC
AGGAACAGGTGGCCTACAGCGTTGGCGACGACACCCGTTTGTTCGTCGTGCAGGGTGCCGGCGACTGGTT
CGATGCCGGCCAGCCGCTGCGCATCGTCGCGCCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTG
CTGTTCGTCGCCGACGGCAGCGACAACACCTAG