SecReT6
Protein ID: 558666130
SecReT6 ID870
T6SS typei4a
Gene symbol-
Locus tagPA1R_gp0168
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]200801..201226 [+]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDU6AMP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|558666130|ref|YP_008802840.1| Uncharacterized protein ImpF [Pseudomonas aeruginosa PA1R]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGSDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|558665962|ref|NC_022806.1|:200801-201226 Pseudomonas aeruginosa PA1R, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCGCGCGAGGTGCGGGCAGCGGTCGAGCATTTCGAGCCGCGTCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCAGCGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA