SecReT6
Protein ID: 558666131
SecReT6 ID870
T6SS typei4a
Gene symbol-
Locus tagPA1R_gp0169
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]201210..203003 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDU6APX9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.90E-182, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|558666131|ref|YP_008802841.1| Protein ImpG/VasA [Pseudomonas aeruginosa PA1R]
MSDSIDADLLDYYQRELTWLRHAGGAFAERYPKVARRLQLAPGECPDPHVERLLEGFSLLTARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTQGSLAEGYRLPRDTALFVTTRGGDSVHFRSSAEATL
WPLAIDEANLLGGEEAQALTGVGAARSALRLSLRCLGEYRWDELSIERLRIHLAASPMGCAILYDLLAAH
TVQVMAGAPGTPPAALRGLPEIVGFAADEALLPEEDGGHPGLRLLAEYFAFPDKFHFFDLPLSGALADGQ
TLYLYLVFDRAPTARLHLQAEDFQLGCAPAINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRAV
RSVAGSTVQPVPAYYGCRHDSHLGTLYWHARRIAGLTPNRLGSDLLLSLVDTGFDPLREAPAFSLTAELL
CTNRYLAERLGAGTTLGFERPGPVAAARLRNAPSAQSQPRLDGQSRWRLVSQLTLNHLSLVEGARALEAL
REILALHNLRDDASARRQIEGLRQLDCQRVVAHVGEDAWRGWRNGLEIRLRLDPQHFVGASGVLFSAVLA
QFFSLYATANRFVRTVLVEADKEVKTWQPQAGSPLSL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|558665962|ref|NC_022806.1|:201210-203003 Pseudomonas aeruginosa PA1R, complete genome
ATGAGCGATTCGATTGATGCCGACCTGCTCGACTACTACCAGCGCGAGCTGACCTGGCTACGGCACGCCG
GCGGCGCCTTCGCCGAGCGCTATCCAAAGGTCGCCCGGCGCCTGCAACTGGCTCCCGGCGAATGCCCCGA
CCCGCACGTCGAGCGTCTGCTGGAAGGTTTCTCGCTGCTCACCGCGCGCCTGCAACGGCGCCTCGACGAC
GACTACGCAGAGTTCAGCGACGCCCTCCTCGAACAGCTCTACCCCCTGGCGCTGCGCCCGCTGCCGTCCT
GCGCGATCGTCCAGTTCGAACCGGACCCGACCCAGGGCAGCCTCGCCGAGGGCTACCGGCTGCCGCGCGA
CACCGCGCTGTTCGTCACCACCCGTGGCGGCGACAGCGTGCATTTCCGCAGCAGCGCCGAGGCGACCCTG
TGGCCGCTGGCGATCGACGAGGCGAACCTGCTCGGCGGCGAGGAGGCGCAAGCCCTGACCGGAGTCGGCG
CCGCCCGCTCGGCGTTGCGCCTGAGCCTGCGCTGCCTGGGCGAGTACCGCTGGGACGAACTGTCGATCGA
GCGCCTGCGCATCCACCTGGCGGCTTCGCCGATGGGCTGCGCGATCCTCTACGACCTGCTCGCCGCGCAT
ACCGTGCAGGTCATGGCGGGGGCGCCCGGCACGCCGCCGGCGGCGCTCCGCGGACTGCCGGAGATCGTCG
GCTTCGCCGCCGACGAGGCGCTGCTGCCGGAGGAAGACGGCGGACATCCGGGCCTGCGCCTGCTCGCCGA
GTACTTCGCCTTCCCCGACAAGTTCCACTTCTTCGACCTGCCACTGTCCGGCGCGCTCGCCGACGGACAG
ACGCTCTACCTGTACCTGGTCTTCGATCGCGCACCGACGGCACGCCTGCATTTGCAGGCGGAAGACTTCC
AGCTCGGCTGCGCGCCGGCGATCAACCTCTTTCCGCGGACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
CAGCGAGTACCGCCTGGTCGCCGACAGTCACCGCGAGAACAGCGTGGAAATCCATAGCATCCGCGCCGTG
CGCTCGGTGGCCGGGAGCACCGTGCAGCCAGTCCCGGCCTACTATGGCTGCCGCCACGACAGCCACCTCG
GCACGCTCTACTGGCACGCCCGGCGCATCGCCGGGCTGACCCCGAACCGGCTGGGCAGCGACCTGCTGCT
GAGCCTGGTGGATACCGGCTTCGACCCGTTACGCGAAGCCCCGGCCTTCAGCCTGACCGCCGAGCTGCTA
TGCACCAATCGCTATCTGGCCGAGCGCCTGGGTGCCGGCACCACGCTGGGCTTCGAACGGCCCGGGCCGG
TCGCCGCCGCACGCCTGCGCAACGCGCCCAGCGCGCAGAGCCAGCCGCGCCTGGACGGCCAGTCGCGCTG
GAGACTGGTCTCGCAGCTGACCCTCAACCACCTGTCGCTGGTGGAAGGCGCGCGCGCCCTCGAAGCCCTG
CGGGAAATCCTCGCCCTGCACAACCTGCGCGACGATGCCAGCGCCCGCCGGCAGATAGAAGGGCTGAGGC
AACTCGACTGCCAGCGGGTGGTGGCGCACGTCGGCGAGGATGCCTGGCGCGGCTGGCGCAATGGCCTGGA
AATCCGCCTGCGACTCGATCCGCAACACTTCGTCGGCGCCAGCGGCGTGCTGTTCTCCGCCGTGCTGGCG
CAGTTCTTCTCGCTGTATGCCACCGCCAACCGCTTCGTGCGCACGGTCCTGGTGGAAGCCGACAAGGAGG
TGAAGACATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGA