SecReT6
Protein ID: 558666132
SecReT6 ID870
T6SS typei4a
Gene symbol-
Locus tagPA1R_gp0170
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]202967..203983 [+]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDU6AQE9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-79, Aligned region: 18..318
Protein Sequence: 338 a.a.     [Download]
>gi|558666132|ref|YP_008802842.1| Uncharacterized protein ImpH/VasB [Pseudomonas aeruginosa PA1R]
MATPGRLAALPLSQRLRRTPQRFELLQALLLLERERPQALPLGTGNAPRAEALRLRGPLLPLFASSEVES
LLDDPQQPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHAPAEFLDLFQHRLLSLLYRVLRKHRVALG
FAVPAATPVQAQLRALSGLLPKALQERLALPDSAVLARTALFAGGRRSLAGFAGLVRQHFGVEARLDAYQ
GAWKEIPAANRSRLQRGGRNLRLGRDAIAGTRTWDEHAGIALSLGPLDAREAARFFPDGDAHGQLASLAA
LYFGPDLDCRLSLLVSGGAPLRLERGAPPRLSWNTGLRRVEDSQRQRIDLDLRQPEVA
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|558665962|ref|NC_022806.1|:202967-203983 Pseudomonas aeruginosa PA1R, complete genome
ATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGAGTCAGCGGCTGCGCCGCACGCCGCAGCGCTTCG
AACTGTTGCAGGCGCTGCTGCTGCTCGAACGCGAGCGTCCCCAGGCGTTGCCGCTGGGCACCGGCAACGC
GCCGCGGGCGGAGGCCCTGCGCCTGCGCGGGCCGCTGTTGCCGCTGTTCGCCTCGAGCGAGGTGGAAAGC
CTGCTCGACGACCCGCAGCAACCGGTGCTGTCCACCCCGGTGTTCGGCCTCGGCGGACCCGACGGCCCGT
TGCCCTATGCCTACCAGGAATGGCTGCAACAACGCGCCCGGCAGAAGGACCATGCCCCCGCCGAGTTCCT
CGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTCTACCGGGTGCTGCGCAAGCATCGCGTGGCGCTCGGT
TTCGCGGTGCCGGCGGCGACCCCGGTGCAGGCGCAGCTACGCGCCCTCAGCGGCCTGTTGCCGAAAGCCC
TGCAAGAGCGCCTGGCGCTGCCGGACAGCGCGGTACTGGCACGCACCGCGCTGTTCGCCGGCGGGCGTCG
CTCCCTGGCCGGCTTCGCCGGCCTGGTGCGCCAGCATTTCGGCGTGGAGGCACGGCTGGACGCCTACCAG
GGCGCCTGGAAGGAAATCCCCGCGGCCAACCGCAGCCGGCTGCAACGCGGCGGACGCAACCTGCGCCTGG
GTCGCGACGCCATAGCCGGCACGCGCACCTGGGACGAGCACGCCGGCATCGCCCTCAGTCTCGGTCCGCT
GGATGCCCGCGAAGCCGCCCGCTTCTTCCCCGACGGCGACGCCCATGGCCAGTTGGCCAGCCTCGCCGCG
CTGTACTTCGGCCCCGACCTGGATTGTCGCCTGAGCCTGCTGGTGAGCGGCGGCGCGCCGCTGCGCCTGG
AGCGCGGTGCACCGCCCAGGCTGAGCTGGAACACCGGCCTGCGGCGCGTCGAAGACAGCCAGCGGCAGCG
CATCGATCTCGACCTGCGGCAGCCGGAGGTAGCCTGA