SecReT6
Protein ID: 558669496
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3592
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4023793..4025142 [-]
ProductOuter membrane protein ImpK/VasF, OmpA/MotB domain protein
NoteTssL
UniProt IDU6AZL2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-70, Aligned region: 66..271
OmpA [PF00691], Evalue: 8.60E-16, Aligned region: 339..437
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 90..139
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 202..268
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 336..369
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 397..434
Protein Sequence: 449 a.a.     [Download]
>gi|558669496|ref|YP_008806206.1| Outer membrane protein ImpK/VasF, OmpA/MotB domain protein [Pseudomonas aeruginosa PA1R]
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSGRGDGLNPLEQ
AAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWG
STSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEAL
RERTAAVIRSTRGEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFK
RIHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDE
FQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c4025142-4023793 Pseudomonas aeruginosa PA1R, complete genome
ATGCCTCCCATCGACGATCCCTTCGGCACCCCGGCCGGCGGCGGCAACGGAAGCCCGCCCGACGACCGCA
CCATGATCATGCCGCGTCCCGGCGGCCGCGCCCCGGAACCGGCCGGCGGCCCCCGCGGCGGCGATCCCTA
CACGCCGCCGCCGATGGCCAGCCTGGCGCCGCTGAGCGGCCGCGGCGACGGCCTCAACCCGCTGGAGCAG
GCCGCCGGCCCACTGCTGGCGATGCTCACCCGCCTGCGCAACACCATCGCCCATCCGGCGCCGGCCAGCC
TGCGCGCGCAACTGCTCGGCTACCTGCGCCAGTTCGAGGAGAAGGCACGCCAGGCCGGCGTGGCGCCGGA
CGAAGTGATGCTGGCGCGCTACGTGCTCTGCACCGCCCTCGACGAAGCGGTGCTCAGCACGCCGTGGGGC
AGCACCAGCGACTGGGGCAAGCAGAGCCTGCTGATCACCCTGCACAACGAGGCCTGGGGCGGCGAGAAGG
TCTTCCAGTTGCTCGAACACTGCCTGCAGAACCCGCACCAGCGCCTGCACCTGCTGGAGCTGCTGTACCT
GTGCACCAGCCTCGGCTTCGAAGGCCGCTACCGGGTCATGCACGACGGCCGCAGCCAACTGGAGGCGCTG
CGCGAGCGCACCGCGGCGGTGATCCGCAGCACCCGCGGCGAGTACGAGCACGAACTGTCGCCGCACTGGC
GCGGCCTCAGCGTGATGCGCGACCGCCTTTCGCAATACCTGCCGCCGTGGGTCGGTATCGCCATCGGCCT
GGCCTTGCTGCTGGCCTTGCTGTTCGGCCTGCGGATGAAGCTGGCCGCCGACGCCGAGCCGGTGTTCAAG
CGCATCCACGCCATCGGCGAGATCCCGGTGCAGGCCATCGACCGCCCGGCGGTGCAGCCGCGGGTGATCG
AGCGGCCACGCCTGGCGCGCTTCCTCGCCGACGACATCAAGGCCCAGCGGGTGGCGGTGGAGGACGCCGT
CGACCGCTCGGTGGTGACCATCCGCGGCGACGAGCTGTTCGCCAGCGCCAGCGCCAGCGTGCGCGACGAG
TTCCAGCCGCTGCTGCTGCGCATCGCCGACGCCCTGCGCAAGGTCAAGGGCCAGGTGCTGGTCACCGGCC
ATAGCGACAACCGGCCGATCGCCACGCTGCGCTACCCGTCCAACTGGAAACTGTCCCAGGCCCGCGCCCA
GGAGGTCGCCGACCTGCTCGGCGCGACCACCGGCGACGCCGGCCGCTTCACCGCCGAAGGGCGCAGCGAC
ACCGAGCCGGTGGCGACCAATGCCAGCGCCGAAGGCCGCGCACGCAACCGCCGGGTGGAAATCACCGTAT
TCGCGGAGGGCGCGCAATGA