SecReT6
Protein ID: 558669498
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3594
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4026499..4026963 [-]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDU6AY20
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-43, Aligned region: 11..146
Protein Sequence: 154 a.a.     [Download]
>gi|558669498|ref|YP_008806208.1| Type VI secretion lipoprotein/VasD [Pseudomonas aeruginosa PA1R]
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFAL
TDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDIT
LGAQAIGIVARPAP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c4026963-4026499 Pseudomonas aeruginosa PA1R, complete genome
ATGCAGAAACTGATCGTCGCGCTGTTCGGGCTGCTGCTCGCCGCCTGTTCGTCCAGCCCGCCGGAAACCC
CGCCGACCCGGGTGGTGATCTGGCTCCACGCCGCACCGAACCTCAACCCGTCCGCCGCCGGCCAGGCGGC
GCCGCTGCGCCTGCGGCTGTACGAGCTGAAGAAAGACACCGCGTTCGGCCGCGCCGACTACTTCGCCCTC
ACCGACAACGCCCAGTCGACCCTCGGTGGCGACCTGGTGGAGCAGGACGAGTTCCTCCTGCGTCCGGGCG
AGGAACGGCGCATCGAACGCACGCTCGACGAGCAGACCCGCCAGCTCGGTTTCGTCGCCGCCTACCGCGA
CCTCGACCGCGCCACCTGGCGCCAGGTCCTCGACGTGCCGGGGCAACGCACCAGCCATCTCGACATCACG
CTCGGCGCGCAGGCCATCGGCATCGTCGCGCGTCCCGCGCCCTGA