SecReT6
Protein ID: 558669499
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3595
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4027008..4028501 [-]
ProductUncharacterized protein ImpI/VasC
NoteFha
UniProt IDU6AX09
KEGG IDpaer:PA1R_gp3595
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 497 a.a.     [Download]
>gi|558669499|ref|YP_008806209.1| Uncharacterized protein ImpI/VasC [Pseudomonas aeruginosa PA1R]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPASVAAPTPPASAAASAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDVLRAR
ASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQA
AIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFGREFSRAYEEH
SARLRRS
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c4028501-4027008 Pseudomonas aeruginosa PA1R, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGCCCAGCCGCTGCCGACGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCAGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCAGCGAGCGTGGCGGCGCCGACGCCGCCGGCAAGCGCCGCCGCGTCGGCCGGCGGCG
ACCTGCTGCAAGCGTTCCTGCGCGGCGCCGGCATGACCCAGTTGAAGGTCGACCCGGCCGGCGCCGAAGC
GCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTGGAAGGACTGGTGGACGTGCTGCGCGCGCGG
GCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTGCAGAACAACCCGCTGAAGT
TCGCGCCGAACGTCGACGAGGCCATGCTGCTCCTGCTGCGCCGCGACAACCAGGCGTTCATGGCGCCGGA
TCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCGCACCAGCTGGCGGTGATGGCCGGCGTGCAGGCC
GCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCGCTGGAAGCCCGCTTCGGCAAGCCGGCCGGGC
TTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTGGGACAGTTTCACCGAGCTGTACGCGAAGAT
CCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGCCGCGAATTCAGCCGCGCCTACGAGGAACAC
AGCGCTCGACTACGGCGTTCCTGA