SecReT6
Protein ID: 558669500
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3596
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4028869..4029903 [+]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDU6AXG8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 156..168
Protein Sequence: 344 a.a.     [Download]
>gi|558669500|ref|YP_008806210.1| Uncharacterized protein ImpA [Pseudomonas aeruginosa PA1R]
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKD
LRVANLLLQSNVALDGLDGLADGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVW
AIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIESGV
AERVGSAQGLDLGPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAAADEQGGAAPVAAVAAPAPRASGEIA
NREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|558665962|ref|NC_022806.1|:4028869-4029903 Pseudomonas aeruginosa PA1R, complete genome
GTGCTGGATGTACCCGTTTTGCTGGCTGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTACG
ACGCCGCGTTCCTCGAACTCGAACGCATCGCCCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGCT
GCCCGCCGAACCGCCGGAGTGGCCGCGCGTACGCGCGCTGGCCAGCGAACTGTTCGGCCGTAGCAAGGAC
CTGCGGGTAGCCAACCTGCTGCTGCAGAGCAACGTCGCCCTCGACGGCCTGGACGGGCTCGCCGACGGCC
TGCTGCTGGTCCGCGAGCTGCTCGGCCAGTACTGGGACGGCGTCTATCCGCTGCTCGACGCCGATGACGA
CAACGACCCCACCTTCCGTATCAACGCCCTCACCGGCCTGGTCGCCGAACCGCTGCTGCAACTGGTCTGG
GCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGGC
TGCAACGCTTCGCCAGCGAGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGA
TGCGCTGGCCGCCACCCGGCGCGCCCTGGAAGGCGCCCAGGAACATGCCCTGGCCATCGAGAGCGGCGTC
GCCGAACGGGTCGGCTCGGCCCAGGGACTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTCC
AGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGGCGAGCCCTTGGCGCCGGGTGCCGAAGCGGCCGCCGA
CGAGCAGGGGGGCGCCGCGCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGAGCCAGCGGCGAGATCGCC
AACCGCGAAGACGTCCTGCGCCAGCTCGACCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGCC
CGGTGCCGGTGCTGCTCAAGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATCT
CATCCCCGATGGGATTTCCCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTAA