SecReT6
Protein ID: 558669502
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3598
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4030523..4032019 [+]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDU6B025
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-195, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|558669502|ref|YP_008806212.1| Uncharacterized protein ImpC [Pseudomonas aeruginosa PA1R]
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLISNDAIKSIESI
IAAIDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQ
SPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWA
NSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVS
KLPSAKEA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|558665962|ref|NC_022806.1|:4030523-4032019 Pseudomonas aeruginosa PA1R, complete genome
ATGGCCGAATTGAGCACCGAGAACCTGGCCCAGGGCCAGACCACCACCGAGCAGACCAGTGAGTTCGCCA
GCCTGCTGCTGCAGGAGTTCAAGCCCAAGACCGAGCGCGCCCGCGAAGCGGTGGAGACCGCCGTGCGGAC
CCTCGCCGAGCATGCCCTGGAGCAGACCAGCCTGATCTCCAACGACGCGATCAAGTCGATCGAGTCGATC
ATCGCGGCGATCGACGCCAAGCTCACCGCGCAGGTCAACCTGATCATGCACCACGCCGACTTCCAGCAAC
TGGAAAGCGCCTGGCGCGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAACTGAAGATCCG
CGTGCTGAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACCACCTGGGACCAG
AGCCCGATCTTCAAGAAGCTCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTATGGCTGCCTGG
TCGGCGACTACTACTTCGACCAGTCGCCGCCGGACGTCGAGCTGCTCGGCGAGATGGCGAAGATCTCCGC
CGCCATGCACGCGCCGTTCATTTCCGCCGCCTCGCCGACGGTGATGGGCATGGGTTCCTGGCAGGAACTG
TCCAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGTTCGCTGCGCGAGT
CCGAGGACTCCCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGGGCGAAGAC
CGATCCGGTGGAAGAGTTCGCCTTCGAGGAAGAAACCGACGGCGCCGACAGCAGCAAGTACGCCTGGGCC
AACTCGGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCTCTACGGCTGGTGCTCGCGGATCC
GCGGCGTCGAGTCCGGCGGCGAGGTGCAGGGCCTGCCGGCGCACACCTTCCCCACCGACGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATTTCCGACCGCCGCGAGGCGGAGCTGGCGAAGAACGGCTTC
ATGCCGCTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGAAACCCG
CCGAGTACGACGATCCGGACGCCACCGCCAACGCCAACCTGGCGGCGCGCCTGCCCTACCTGTTCGCCAC
CTGCCGCTTCGCCCATTACCTGAAGTGCATCGTTCGCGACAAGATCGGTTCCTTCAAGGAGAAGGACGAG
ATGCAGCGCTGGCTGCAGGACTGGATCCTCAACTACGTCGACGGCGACCCGGCCCACTCCACCGAGACCA
CCAAGGCCCAGCACCCGCTGGCGGCGGCCGAAGTGGTGGTGGAGGAAGTCGAAGGCAATCCGGGTTACTA
CAACTCGAAGTTCTTCCTTCGCCCGCACTACCAGCTCGAGGGACTGACGGTATCGCTACGCCTGGTATCC
AAGCTGCCTTCGGCCAAAGAGGCCTGA