SecReT6
Protein ID: 558669503
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3599
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4032095..4032583 [+]
ProductUncharacterized protein ImpD
NoteTssD
UniProt IDU6AY25
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|558669503|ref|YP_008806213.1| Uncharacterized protein ImpD [Pseudomonas aeruginosa PA1R]
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLM
MACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQK
ADGAKDGGPVKYGWNIRQNVQA
 
Nucleotide Sequence: 489 bp     [Download]
>gi|558665962|ref|NC_022806.1|:4032095-4032583 Pseudomonas aeruginosa PA1R, complete genome
ATGGCTGTTGATATGTTCATCAAGATCGGCGACGTCAAGGGTGAGTCCAAGGACAAGACTCACGCCGAGG
AAATCGACGTGCTGGCATGGAGCTGGGGCATGTCCCAGTCCGGGTCGATGCACATGGGCGGTGGCGGCGG
CGCCGGCAAGGTCAACGTGCAGGACCTGTCGTTCACCAAGTACATCGACAAGTCCACGCCCAACCTGATG
ATGGCCTGCTCCAGCGGCAAGCACTATCCGCAGGCGAAGCTGACCATCCGCAAGGCCGGCGGCGAGAACC
AGGTCGAGTACCTGATCATCACCCTGAAGGAAGTCCTGGTGTCCTCGGTGAGCACCGGCGGCAGCGGTGG
CGAGGATCGCCTGACCGAGAACGTGACCCTGAACTTCGCCCAGGTCCAGGTCGACTACCAGCCGCAGAAG
GCGGATGGCGCGAAGGACGGCGGTCCGGTCAAGTACGGCTGGAACATCCGCCAGAACGTGCAGGCCTGA