SecReT6
Protein ID: 558669505
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3601
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4033598..4034107 [+]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDU6AXH3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|558669505|ref|YP_008806215.1| Uncharacterized protein ImpF [Pseudomonas aeruginosa PA1R]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVLRDLAWLFNTTSLFDHGPAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|558665962|ref|NC_022806.1|:4033598-4034107 Pseudomonas aeruginosa PA1R, complete genome
ATGGCCGAACTGACCCTCCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAGCCGG
GCAACCTCAAGGAAGCCGCGGAGCGCCGGGTGCTGACCCTGAACCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACTTCGCTGTTCGACCACGGCCCCGCCGCACGGATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGCTGCTCACCGAGACCATCGCCACCTTCGAGCCGCGCATCATCCGTTCTTCGTTGCGGGTGCGTGC
GCAACTGCTGCCCGGCGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGCGACCTCTGGGCCGAA
CCGGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGCCACGTGCGCGTCGCCCAGG
GCGAGCGGAGGCGTACATGA