SecReT6
Protein ID: 558669507
SecReT6 ID871
T6SS typei3
Gene symbol-
Locus tagPA1R_gp3603
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]4035927..4036973 [+]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDU6B028
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-112, Aligned region: 20..319
Protein Sequence: 348 a.a.     [Download]
>gi|558669507|ref|YP_008806217.1| Uncharacterized protein ImpH/VasB [Pseudomonas aeruginosa PA1R]
MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLGHSVRLADDPLRLGQKPDCTFAPSTL
ASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTEYARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEA
RPEISHDRIDDDYWSARLAALSGRGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVA
VEEYVGQWLELPERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWV
AEYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPHEHKEKEHE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|558665962|ref|NC_022806.1|:4035927-4036973 Pseudomonas aeruginosa PA1R, complete genome
ATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGAACCTGCTCGCCGGGATGGCGGCGGCGCCCTGGG
ACTATGACTTCTTCCAGGCGCTGCGGCGCATCGAGTGCGAGTCGCCGCAACTGCCGCGCCTCGGTCATTC
GGTGCGGCTGGCGGACGACCCGCTGCGTCTCGGGCAGAAGCCCGACTGCACCTTCGCGCCCTCGACCCTG
GCCTCGGTGAGCCAGGCCGGCACCGCTGCGGTGCCGCGCCTGGACCAGTTCTTCTTCGGCCTCACCGGCC
CCAACGGGCCGCTGCCGCTGCACCTCACCGAATACGCCCGGGAACGCCAGCGCAACGTCAACGACGCGAC
CTTCAAGCGCTTCATGGACGTCTTCCACCACCGCCTGCTGACCCTGTTCTACCGGGCCTGGGCGGAGGCG
CGGCCGGAGATCAGCCACGACCGGATCGACGACGACTACTGGTCGGCGCGCCTCGCCGCGCTCTCCGGGC
GCGGCATGCCGAGCCTGCGGGGGCGCGAGCCGCTGGCGGATACCGCACGCTACTACTACACCGGCCACCT
CGCCGCGCAGACCCGCTACCCGGACGGCCTGCGGGTGATCCTCGCGGAGTATTTCGAGGTCCCGGTGGCG
GTCGAGGAATACGTCGGCCAATGGCTGGAGCTGCCCGAGCGCAGCCGCCTCGGCGTCGACTCGACGAGCC
TGGGCATGGACGTCTGCCTGGGCACCCACGTCTGGGACCGCCAGCACAAGTTCCGCCTGCGCCTGGGGCC
GCTGGACCTCGATCAATACCAGCGCTTCCTGCCCGACGGCGACCACTTCGTCGAGCTGGCCGCCTGGGTC
GCCGAATACCTGGGCGAGGAGCTGGACTGGGACGTCAACCTGGTCCTGCAACGCCACGAAGTACCCCCGC
TGGGCCTGCAGGGCGGCGGGCGGCTCGGTTTCAACACCTGGCTGGGCGATCCCGGCCAGGACGCCAGGGA
TCTACTGCTGGCCCGCCAGTACGCCACTGCGCGGCCGCACGAGCACAAGGAGAAGGAACATGAGTGA