SecReT6
Protein ID: 558675843
SecReT6 ID874
T6SS typei3
Gene symbol-
Locus tagPA1S_gp3588
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]4015742..4018840 [-]
ProductSerine/threonine protein kinase
NotePpkA
UniProt IDU6AGB1
KEGG IDpaep:PA1S_gp3588
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 7.80E-53, Aligned region: 9..249
Pkinase_Tyr [PF07714], Evalue: 7.10E-36, Aligned region: 10..248
VWA_2 [PF13519], Evalue: 1.50E-13, Aligned region: 96..154
VWA_2 [PF13519], Evalue: 1.50E-13, Aligned region: 616..791
APH [PF01636], Evalue: 1.10E-05, Aligned region: 12..122
APH [PF01636], Evalue: 1.10E-05, Aligned region: 122..150
APH [PF01636], Evalue: 1.10E-05, Aligned region: 214..264
Kinase-like [PF14531], Evalue: 0.00023, Aligned region: 120..212
VWA [PF00092], Evalue: 0.00051, Aligned region: 616..772
Kdo [PF06293], Evalue: 0.0071, Aligned region: 101..149
Protein Sequence: 1032 a.a.     [Download]
>gi|558675843|ref|YP_008812551.1| Serine/threonine protein kinase [Pseudomonas aeruginosa PA1]
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTLARLSHPNTVT
IHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPEQGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKD
SLSTALAHLTEPLPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQG
SPRASNPPPAEPAPLPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGG
SRTPLIAAAAAAVLLAIGGGAWWLLGSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDGWLPASAVSDW
KQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLL
PIFDSKESFDADGQPAQLLEVASIDPGGSATAPQAPGQAGRGGASGAASDTFRTGIVLVVDTSVSMQPYI
DRVREVIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATD
VSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYAL
HLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQS
LKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWL
SLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP
 
Nucleotide Sequence: 3099 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c4018840-4015742 Pseudomonas aeruginosa PA1, complete genome
ATGGACATAGAACTTCCGGGATTCGACATCGAACGCGAGCTGGGCGAAGGCGCCATGGCCACGGTCTACC
TGGCCACCCAGCGCTCGCTGCAGCGCAAGGTGGCGCTGAAGGTGATGGCCGCGGCGCTGGCCGCCGACCC
GAGCTTCGCCGAACGCTTCCTGCGCGAAGGTCGGACCCTGGCGCGGCTGTCGCACCCGAACACGGTGACC
ATCCACGACATCGGCAACGTCGGCAGTTGCTACTACATGGCCATGGAATACCTGCCCAACGGCACGCTCA
AGGAGCGCATCCAGCAGGGCCTCGATCCCGAGCAGGGCCTGGCCTACGTACGGCAGGTGGCCGCCGCGCT
CGGCTACGCGCACTCCCAGGGCCTGGTGCATCGCGACGTGAAGCCGGCCAACATCCTGTTCCGCGCCGAC
GGCACCGCGGTGCTCTCGGACTTCGGCATCGCCAAGTCGATCGAGGACAATACCCAGTTCACCCAGGTCG
GCTTCGCCGTCGGCACCCCCAGCTACATGAGCCCGGAGCAGGCCCGCGGGCAGGAGATCGACGGCCGCGC
CGACCTCTACGCGCTGGGCGTGGTGCTCTACGAGATCCTCACCGGCAAGCTGCCCTACAACGGCAAGGAC
TCGCTCTCCACCGCCCTGGCCCACCTCACCGAGCCGCTGCCGGAACTGCCGATCGAGCAGGGCCGCTACC
AGGACATCCTGCGCCAGTTGCTGGCCAAGGACCCGGCCGAGCGCTTCCCCACCGCCGGCGCGTTGATCGC
CGCCCTCGACCGCCTGGCGCCGAGCGCCCTGGAAGCCACCCAGATCCGTCCGCTGGCGACGCCGCAGGGC
TCGCCGCGAGCGAGCAACCCGCCGCCGGCCGAACCCGCGCCCCTGCCGCCCGCCGACCTCGGCGGCCTGC
AACCGGTGTCGATCCAGTTGCCGCCGGTCACGCCCAGCGCCGGCGGCGCCACGCCGCCTCCGCCTCCGCC
GTCGCAAGCGGCGAAACCGCCATCGCCCCCGCCGCCTCCGTTGCCGCCGGCGAAGCCACGTGCCGGCGGC
AGCCGCACGCCGTTGATCGCCGCCGCCGCGGCCGCCGTGCTCCTGGCGATCGGCGGCGGCGCCTGGTGGC
TGCTGGGCTCGGGCGACGCGCCGAGCGCTGCCGATCCAGCGCCGCTGGGACAGACGCCGGCGGACAAGCC
GCAGCAGCAGACCCCGGTGGCCGATGCCGAACAGGACGGCGGCGAGCGTCCGCTGCTGATGCCAGGCAAG
AAGACGCTGTTCCAGCGCGTCCTGACCAAACCCGGCGCGGCCATCTCCGCCGAGGCTGGCGGCCCGCCCC
GGGCCGGCGCGGTGCCGGCCTTCTCGGTGCTCTACGTGTACGCCCGCAAGCAGGTCGGCGGCAGCCCCTG
GCTGCGCGTCGGCGCCTCCAGCAACGGCGAGGGCGACGGCTGGCTGCCGGCCAGCGCGGTGAGCGACTGG
AAGCAGAGCCTGGTGCTGAAGTTCACCGAACGCTCCGGCCGCGCGCCGGTGATGTTCCTCAACAGCGCCG
AGCAGGTCGAACGCCTGCTCGGCGATACCCGCGCGGCGCGCGACACCCTGACCCAGGCGGTGGACCACAA
GGGCGATCCGCAGGTGGTCGCGGTCGAGCCCAACGACCGGGCGATCCCCCAGGACCAGTTCTACCTGCTG
CCGATCTTCGACTCGAAGGAGAGCTTCGACGCCGACGGCCAGCCGGCGCAGTTGCTGGAGGTCGCTTCGA
TCGACCCCGGCGGCAGCGCCACGGCACCCCAGGCGCCGGGCCAGGCCGGGCGGGGCGGCGCCAGCGGCGC
GGCGAGCGACACCTTCCGCACCGGCATCGTCCTGGTGGTGGACACCTCGGTGTCGATGCAGCCCTACATC
GACCGCGTGCGCGAGGTGATCGACGGCCTGCAGCGGCAGATCGGCGAGCGCGGCGACCTGGACAAGGTCA
GCTTCGGCCTGGTCGGCTTCCGCAACAACACCGACAAGACCCCCGGCCTGGAATACGTCAGCAAGACCCT
GGTGCCGCTGCAACCGGGCAACGACGCGCAGCGCTTCGCCGAGTTGAGCAGCCAGGTGCGCGCCACCGAC
GTCTCCAGCCACTCGTTCAACGAAGACGCCTTCGCCGGGATCATGCAGGCGGTCGACGAAATGGACTGGT
CGCCCTACGCCGGGCGCGTGGTGCTGCTGGTCACCGACGCCGGCGCGCTGCGCAAGAACGACCCGCTCGG
GCGTACCCAGATGAACGAGGCCGAGGTCCGCCAGGCGGCGCTGCGCAAGGGCGTGAAGATCTATGCCCTG
CACCTGCGCACCCCGGCCGGGAAGAACAACCACGGCTACGCCGAGCAGCAGTACCGCAGCCTCACCGCCG
ACGCCAACCCGAAGATCGCCGACCTCTACATCCCGGTGGCCGGCGGCGAGGTGAACGCCTTCGGCAACAC
GGTGAAGGAGATCGGCACGGTGTTCGCCGACCTGGTCCACGACGCCGGCAACCGCAAGCCGCAGGCGCCG
CGCTTCGACGCCGCGCCAAGCGTGGCGAGCAAGTCGGCGGCCATCGGCTACGCCATGCAGATGGAATTCC
TCGGTCGCCGCGACCCGGTGCGCGCGCCGCAGGTCGTCACCGCCTGGACCGCCGACCGCGACCTGACCAA
CCCGGCGCTGCCGGCGTTCCAGGTCTGCGTGCTGCTGAGCAAGCTGCAACTCAACGAACTGCAACAGTCG
CTGAAACTGATCGTCGACGCGGCCAAGCGCACCCAGACCTCGCCCAAGGACTTCTTCCAGGAAATCGCCA
GCGCCAGCGCCTACATGAGCCGCGACCCGGCGCAACTGGTGAAGGGCAGCAACCTGGCGCAGAGCGGCGT
GCTCGGCGAATACCTGGAAGGCCTGCCGTACCGCAGCAAGTCGCTGAACATGACCCAGGACCTCTGGCTG
TCGCTGAGCGTCGCCGAACAGCAGGACTTCATCGACGAACTGGAGTCGAAGATCCGCCTCTACGAAACCT
TCCACAACGACGTCGCCAACTGGGTCCGGTTCGGCGACGCCGACGCCGGCGACGCGCTGTATCGCGTGCC
GCTGTCGACGCTGCCATGA