SecReT6
Protein ID: 558675844
SecReT6 ID874
T6SS typei3
Gene symbol-
Locus tagPA1S_gp3589
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]4018848..4019576 [-]
ProductPhosphoprotein phosphatase PppA
NotePppA
UniProt IDU6AFC5
KEGG IDpaep:PA1S_gp3589
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.50E-13, Aligned region: 20..208
PP2C [PF00481], Evalue: 3.30E-11, Aligned region: 29..234
SpoIIE [PF07228], Evalue: 2.40E-07, Aligned region: 38..240
Protein Sequence: 242 a.a.     [Download]
>gi|558675844|ref|YP_008812552.1| Phosphoprotein phosphatase PppA [Pseudomonas aeruginosa PA1]
MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMGGHAAGDFVSSLIVDTLRRIPAASSLP
AYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSY
VQELLDNALISEEEARHHPRANVVTRAVGVHEQLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLS
HSDPYAVVRSLIHLGLTRGAPDNITALVVRAF
 
Nucleotide Sequence: 729 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c4019576-4018848 Pseudomonas aeruginosa PA1, complete genome
ATGGTGCCCAACTCAGTCAGCTACTACAGGTCGGCCAGCTACAGCCACGTCGGCATGGTCCGCAAGGTCA
ACGAAGACGCCAGTCTCGACGCCCCAGAGTCGGGACTCTGGGTGGTCGCCGACGGCATGGGCGGCCACGC
CGCCGGCGACTTCGTCAGCAGCCTGATCGTCGATACCCTGCGGCGCATCCCGGCGGCCTCCTCGCTACCG
GCCTACGTCGGCGCGTTGCGCACCGGCCTCGCCCAGGTCAACGAGCGGGTTCGCCAGGAGGCCGGCCTGC
GTGGCGTCAGCGTGATGGGCAGCACCCTGGTACTGCTCGCCGCGCGCGGCAACCAGGCGAGCTGCCTGTG
GGCCGGCGACAGCCGCCTGTACCGCCTGCGCGGCGGCGTGCTGGAAGCCATCTCGCGGGACCACAGCTAC
GTCCAGGAGCTGCTCGACAACGCATTGATCAGCGAGGAAGAGGCGCGCCACCATCCGCGCGCCAACGTGG
TCACCCGCGCGGTCGGCGTGCACGAGCAACTGGAACTGTCGGAAGCCGCGCTGCACGTGCTGCCCGGCGA
CAGCTTCCTGCTCTGCAGCGACGGCCTCAACAAGACCGCCGACGACAGCGAACTGCGCGACGTGCTCAGC
CACAGCGATCCCTATGCGGTGGTCCGCAGCCTGATCCACCTGGGCCTGACCCGCGGCGCCCCGGACAACA
TCACGGCCCTGGTGGTCAGGGCCTTCTGA