SecReT6
Protein ID: 558675845
SecReT6 ID874
T6SS typei3
Gene symbol-
Locus tagPA1S_gp3590
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]4019586..4020266 [-]
ProductProtein phosphatase ImpM
NoteTagF
UniProt IDU6AFR7
KEGG IDpaep:PA1S_gp3590
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 6.10E-51, Aligned region: 5..142
Protein Sequence: 226 a.a.     [Download]
>gi|558675845|ref|YP_008812553.1| Protein phosphatase ImpM [Pseudomonas aeruginosa PA1]
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRFAIAPGLLGGE
AVAGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLP
APPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRF
LTGEGEVIPLFPGIPG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c4020266-4019586 Pseudomonas aeruginosa PA1, complete genome
TTGAACAGCGTCGGTTTCTACGGCAAGCTGGCCGGCCGCGGCGATTTCGTCAGCCGCGGCCTGCCGAACA
CCTTCGTCGAACCCTGGGACGCCTGGCTGGCCAGCGGCATGCGCGCCAGCCAGGACGAACTCGGCGCGGC
CTGGCTCGACGCCTACCTGACCAGCCCGCTGTGGCGCTTCGCCATCGCCCCCGGCCTGCTCGGCGGCGAA
GCGGTGGCCGGGGTGGTGATGCCGAGCATCGACCGGGTCGGTCGCTATTTCCCGCTGACCGTCGCCTGCC
TGCTGCCGGCGAACGCCGACCTCGGCGGGCTGGTCGGCGGCGACGACGGCTGGTTCGAGCAGGTCGAGAG
CCTGCTGCTCTCCACCCTCGAACCGGAGGCCGAGGTCGAGGCCTTCGAGCAGGCGGTGGCGCAGCTCCCG
GCCCCTCCCTGCGGACCGCGCATCGAACAATCGCTGATCAGCGGCAACCTGCTGCGCAGCGAAGCGGTGA
CCCCGGCGCAGCGCCTCGCCGCGCTGGCCCAGCATGCCTGCGACGGCGCCAGCCACTGGTGGGGACGCGG
CTCGGCACGGATCTCCGCCGGCCTGATGCGCTACCAGGGCCTGCCGCCGGCGCCGGCGTTCGGACGATTC
CTCACCGGAGAGGGCGAGGTGATCCCGCTCTTTCCCGGCATACCCGGTTAA