SecReT6
Protein ID: 558675848
SecReT6 ID874
T6SS typei3
Gene symbol-
Locus tagPA1S_gp3593
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]4025149..4026483 [-]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDU6AGB5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-158, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|558675848|ref|YP_008812556.1| Uncharacterized protein ImpJ/VasE [Pseudomonas aeruginosa PA1]
MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGFSELKLDDALLTQGKLAIVSARGVLP
DGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPLKRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFES
RAPVALGSQAFRLLTERDGLGEYAAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLL
HQRGEALAGRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQ
RRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLIDNASFVLVVR
ADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPYHAGSTYFELDRGSAHWKQLTH
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c4026483-4025149 Pseudomonas aeruginosa PA1, complete genome
ATGTCCTGGAATAACCGCGTGGTGTGGTCCGAAGGCATGTTCCTGCGGCCACAGCATTTCCAGCAGCACG
ACCGCTACCTGGAAACCCTGGTGGATGGCCGCTGCCGCTCGCTCCTGGCGGGCGGCTGGGGCTTTTCCGA
GCTGAAGCTGGACGATGCCCTGCTGACCCAGGGCAAGCTGGCCATCGTCAGCGCCCGCGGCGTGCTGCCG
GATGGTACGCCGTTCAACATCCCCGCCGACGATCCGGCGCCGGCGCCGCTGAATGTCGAGGAAAGCCTGC
GCGATGGCATCGTCTACCTCGGCCTGCCGCTGAAGCGGGTCGGCACCCGCGACACGGTAGAGGAGGGCGA
GGCCCTCGGCGGCGCCCGCTACGTCAGCCAGGTGCAGGAAGTGCGCGACGACAATGCCGCCTTCGAGAGC
CGCGCCCCGGTGGCCCTGGGCAGCCAGGCGTTCCGCCTGCTGACCGAGCGCGACGGCCTCGGCGAATACG
CCGCGGTGGGCGTCGCGCGGGTCCGCGAGAAGCGCGCGGACCAGGCCCTGAGCCTGGACGAGGACTACCT
GCCGCCGGTGCTCGACATTGCCGCCGCGCCGCCCCTGGCGTCCTTCGCCAAGGAGCTGCTGGGCCTGCTC
CACCAGCGCGGCGAAGCCCTCGCCGGGCGGGTGGTGGCATCCAGCGCCGGGGGCGCCTCGGAAATCGCCG
ACTTCCTGCTGCTGCAACTGGTCAACCGCGCCGAGGCCCTCACCGGTCACCTGTCCCGCGTGCGCCCGCT
GCACCCGCAGGAGCTGTACCGCGAACTGGTGGCCCTGGCCGGCGAGTTCTGCACCTTCACCGCCAGCCAG
CGGCGTCCCGAGGAGTACCCGGTGTACAACCACGACGACCTGGCCGCCAGCTTCGCCCCGGTGATGCTCG
CCCTGCGCCAGGCGCTGGCGACGGTGATCGACGCCAAGGCGATCGCCATCCCGATCGTCGAGAAGGCCTA
CGGCGTCCACGTCGCGATGCTCAGCGACCGCAGCCTGATCGACAACGCCAGCTTCGTCCTGGTGGTGCGC
GCCGACGTCCCCGGCGAGAGCCTGCGCGGGCACTTCCCGCAGCAGGCCAAGGTCGGCTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAACTGCCGGGTATCGGCCTGCTGCCGATGCCGGTGGCGCCGCGGCAGAT
CCCCTACCACGCCGGCTCCACCTATTTCGAACTGGACCGCGGCAGCGCGCATTGGAAGCAGCTGACGCAC
TCCGGCGGCTTCGCCTTCCACATCGCCGGCCAGTTCCCCGGGCTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA