SecReT6
Protein ID: 558675850
SecReT6 ID874
T6SS typei3
Gene symbol-
Locus tagPA1S_gp3595
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]4027008..4028501 [-]
ProductUncharacterized protein ImpI/VasC
NoteFha
UniProt IDU6AFS2
KEGG IDpaep:PA1S_gp3595
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 497 a.a.     [Download]
>gi|558675850|ref|YP_008812558.1| Uncharacterized protein ImpI/VasC [Pseudomonas aeruginosa PA1]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPASVAAPTPPASAAASAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLVEGLVDVLRAR
ASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQA
AIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFGREFSRAYEEH
SARLRRS
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c4028501-4027008 Pseudomonas aeruginosa PA1, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGCCCAGCCGCTGCCGACGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCAGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCAGCGAGCGTGGCGGCGCCGACGCCGCCGGCAAGCGCCGCCGCGTCGGCCGGCGGCG
ACCTGCTGCAAGCGTTCCTGCGCGGCGCCGGCATGACCCAGTTGAAGGTCGACCCGGCCGGCGCCGAAGC
GCAGATGGAAGCCATCGGCCGCAGCTATCGCGGCCTGGTGGAAGGACTGGTGGACGTGCTGCGCGCGCGG
GCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTGCAGAACAACCCGCTGAAGT
TCGCGCCGAACGTCGACGAGGCCATGCTGCTCCTGCTGCGCCGCGACAACCAGGCGTTCATGGCGCCGGA
TCGCGCGGTGGCCGACAGCTTCGAAGACCTCAAGGCGCACCAGCTGGCGGTGATGGCCGGCGTGCAGGCC
GCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCGCTGGAAGCCCGCTTCGGCAAGCCGGCCGGGC
TTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTGGGACAGTTTCACCGAGCTGTACGCGAAGAT
CCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGCCGCGAATTCAGCCGCGCCTACGAGGAACAC
AGCGCTCGACTACGGCGTTCCTGA