SecReT6
Protein ID: 558675852
SecReT6 ID874
T6SS typei3
Gene symbol-
Locus tagPA1S_gp3597
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]4029992..4030510 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDU6AII3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.60E-60, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|558675852|ref|YP_008812560.1| Uncharacterized protein ImpB [Pseudomonas aeruginosa PA1]
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADRKFLEIDVDNF
DARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKT
GAEEMIMKAIKDPALLQALASAPKPKDDEPQA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|558672313|ref|NC_022808.1|:4029992-4030510 Pseudomonas aeruginosa PA1, complete genome
ATGGGAAGCACTACCAGCAGTCAGAAGTTCATCGCCAGGAACCGGGCGCCACGCGTGCAGATCGAGTACG
ACGTGGAGTTGTACGGTGCCGAGAAGAAGGTCCAGCTGCCCTTCGTCATGGGCGTCATGGCCGACCTCGC
CGGCAAGCCCGCCGAACCCCAGGCGGCGGTCGCCGACCGCAAGTTCCTGGAGATCGACGTGGACAACTTC
GATGCCCGGCTGAAGGCGATGAAGCCGCGGGTGGCCTTCAACGTACCGAACGTGCTGACCGGCGAAGGCA
ACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCCGCCGCGGTGGCGCGCAAGGTCGA
TTCGCTGAACAAGCTGCTCGAGGCGCGTACCCAGCTGGCCAACCTGCTGACCTACATGGACGGCAAGACC
GGCGCCGAGGAAATGATCATGAAGGCGATCAAGGACCCGGCCCTGCTTCAGGCCCTGGCCAGCGCGCCGA
AGCCCAAAGACGACGAGCCGCAGGCGTAA