SecReT6
Protein ID: 558677479
SecReT6 ID875
T6SS typei1
Gene symbol-
Locus tagPA1S_gp5238
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]5826493..5826999 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDU6AK27
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-53, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|558677479|ref|YP_008814187.1| Uncharacterized protein ImpB [Pseudomonas aeruginosa PA1]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRGDERKVEDRKPIGIDKMTFDEVLAKQE
LGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDESRSRVLGELGLSAAPSQDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|558672313|ref|NC_022808.1|:5826493-5826999 Pseudomonas aeruginosa PA1, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCAAAGGAACGCATCAACGTCACCTTCAAGCCCGCCACCGGCGGTG
CCCAGGAGGAAATCGAACTGCCGTTGAAGCTACTGGCGATCGGCGATTACACCCAGCGCGGGGATGAGCG
CAAGGTGGAGGACCGCAAGCCGATCGGCATCGACAAGATGACCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGGGGCTGACGCTGAGCGTACCCAATCGTCTCCAGGAGGAGGGCGGCAGCGACGAGCTGGCGGTGGGGC
TGCAGATCAACTCGATGAAGGACTTCAACCCGGCCAGCATCGTCGAGCAGGTGCCCGAGCTGAAGAAGCT
GATGGAGTTGCGCGATGCGTTGGTGGCCCTCAAGGGCCCGCTGGGCAACGCCCCGGCGTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGAGTCCCGTAGCCGTGTGCTGGGCGAGCTGGGGCTGAGCGCCGCCC
CCTCCCAGGACGCCTGA