SecReT6
Protein ID: 558677486
SecReT6 ID875
T6SS typei1
Gene symbol-
Locus tagPA1S_gp5245
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]5836428..5837621 [+]
ProductUncharacterized protein ImpI/VasC
NoteFha
UniProt IDU6AMP7
KEGG IDpaep:PA1S_gp5245
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.80E-14, Aligned region: 30..96
Protein Sequence: 397 a.a.     [Download]
>gi|558677486|ref|YP_008814194.1| Uncharacterized protein ImpI/VasC [Pseudomonas aeruginosa PA1]
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGAFYLTDTSSNG
IRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDELAMDVGRPQPAGSIIPDDAFLALDPLQALD
QDGADAYELDDLSAIAQPSHEAGARADYARIDMESLVVPELVPAPAAPQEPVESPPPERDEAFWQRFGQA
LGVDLEGLDGAAREALAIDAAGLLRQCIGGLQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEAL
GHLLRDGKPGQLSGEQAVARSFRDLQAHQVALLGASRAAVRATLEHFSPQQLALRFERDGRRPLLATSGS
RWRAYGRYHQSLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|558672313|ref|NC_022808.1|:5836428-5837621 Pseudomonas aeruginosa PA1, complete genome
ATGGAACTGGTATTGGAAATGCTCAGCGCCAAGCAATTCGTACCGACAGAGCTATGCAGCAAGACCTTCG
GCAGGAACGGCGGCCTCATCGGCCGCGGCGGTGAGTGCGATTGGGCGATTCCCGATCGCAAGCGGCACCT
GTCCAAGCAGCATGCGCGGGTCAGCTATCGCAACGGCGCGTTCTACCTGACCGACACCAGCAGCAACGGC
ATCCGCGCCGGCAACGGCAGCCGCCTGCCGCATGGCGAGCCGCAGCGCATCGAGCAGGACAGCGTCTTCC
TGCTCGGCGACTTCGAGATCCGCGCGCGGTTGCTGCGCGAGCCCGACGAGCTCGCCATGGACGTCGGGCG
GCCGCAGCCGGCGGGCAGCATCATTCCGGACGATGCCTTCCTGGCCCTCGATCCGTTGCAGGCGCTCGAC
CAGGACGGTGCAGATGCCTACGAACTCGACGACCTGAGCGCGATCGCCCAGCCCAGTCATGAGGCCGGGG
CGCGTGCGGACTACGCGCGGATCGACATGGAAAGCCTGGTCGTACCGGAGCTGGTGCCCGCCCCGGCGGC
TCCGCAGGAACCCGTGGAAAGTCCGCCTCCGGAACGCGACGAAGCCTTCTGGCAGCGTTTCGGCCAGGCG
CTCGGAGTGGACCTCGAAGGCCTCGACGGCGCTGCGCGCGAAGCGCTGGCGATCGACGCCGCCGGTTTGC
TGCGGCAGTGCATCGGCGGCTTGCAGCAGAGCCTGCGGACCCGCAGCGAACTGAAGAACGAACTGCGCCT
GTCGCTGAGCACGTTGCGCGATACCGGCAAGAATCCCTTGCGCTTCAGCGCCGATGCCGGCGAGGCGCTG
GGGCATCTGCTACGGGATGGCAAGCCTGGCCAGTTGAGTGGCGAACAGGCCGTCGCACGCAGTTTCCGCG
ACCTCCAGGCGCACCAGGTGGCGCTGCTCGGCGCCAGCCGGGCGGCGGTGCGCGCGACCCTCGAGCATTT
CTCGCCGCAGCAGCTGGCCCTGCGTTTCGAGCGCGACGGTCGCCGGCCGTTGCTGGCCACCTCGGGCAGC
CGCTGGCGTGCCTACGGTCGCTACCACCAGTCGCTATGCCAGGACGACGATTGGAGCGAGCGTCTGTTGG
CGCGTGATTTCGCCCAGGCCTACGAAGAGCAGGTTCGCCTGATTTCCACCCTCTACACCGAGCACCAAGG
ATGA