SecReT6
Protein ID: 560174087
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2244
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2365103..2367463 [+]
Producttype VI secretion system, effector protein VgrG-like
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.7e-90, Aligned region: 31..336
Protein Sequence: 786 a.a.     [Download]
>gi|560174087|ref|CDG12819.1| type VI secretion system, effector protein VgrG-like [Serratia marcescens subsp. marcescens Db11]
MPKAGNSMDRLIIAHTPLPSHQLLFRSLSGEEKLAGLFEFDVELLSPDNRLDLKALLGQKITLELRGNPL
APRYLNGNITRMTLSGREAGGNRYYIYRAVLRPTLWYLTQNRDFRIHQEKTVPDILTQVLGQYQVKIDNR
LSYDYRIWGYCVQYQESDFDFISRLMEHEGIYYYFTHQQDGHTLVLADAPAAHQELAGYASIPYQLAEGG
LVENKDSINSWSVSDAITPSLYSLDDYDFRKPRARLLEARQNPASFAQDKAEVFDWPGRYTDHAHGQFYV
KVRQQEFEAQHEQMSGEGNSQGIAPGYRFQLTQAPRMEDNRAYLVVSAQYFMQENSYASNDNDVGEQRTE
FQVVPADINWRPARTTPWPKTHGPQTAEVVGPEGESIWTDKYGRVKLKFRWDRHGSGNETSSCWVRVSSA
WAGWKYGGIQIPRVGEEVVVDFINGDPDRPIITGRVYNEDSMPPWDLPGDATKMGFMSRSKGGGADNASF
LFLEDSPGNESFDMHAERNMNMTVENDKNVNIDGSRTTTIGRQQDDTVTGDATFLYKAKRTTTVNGLDTA
NLNAHQTVNIKGGRDLTIIDGGDKIDITGNQSFKLDGAQTQNITQTQHVTVKGNQTLDITEGQQTSTIKQ
GQTVNITAGGQHTTITAGGQVLTIEAGGQTATVTGDVTETYNNNQNTTITGTLTIKAKTIDITSADGVSV
QTPNWKDNCHGWKWVATGANFAFYGSNLSLTATSLKHTMLDISHNPLSISKTNFKLSNDPMTFTQLGALV
TNGALRLSTKALAIFL
 
Nucleotide Sequence: 2361 bp     [Download]
>gi|560171871|ref|HG326223.1|:2365103-2367463 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGCCTAAAGCGGGGAATAGTATGGATCGTCTTATCATTGCGCACACGCCCTTGCCCTCCCATCAGCTGT
TGTTCAGAAGCCTTTCCGGCGAGGAAAAACTGGCCGGATTGTTCGAGTTCGACGTCGAGTTGCTCAGCCC
CGACAATCGGCTCGATCTGAAAGCGCTGCTGGGACAAAAAATCACGCTGGAGCTGCGGGGCAATCCGTTG
GCGCCGCGTTATCTCAACGGCAATATCACGCGCATGACCCTCTCCGGCCGAGAAGCTGGCGGCAACCGTT
ACTATATCTACCGCGCCGTGCTGCGCCCCACGCTGTGGTATCTGACGCAAAACCGCGATTTTCGCATCCA
CCAGGAAAAAACCGTTCCCGACATCCTGACTCAGGTGCTGGGGCAGTATCAGGTGAAAATCGATAACCGC
CTGAGTTACGACTACCGCATCTGGGGATACTGCGTGCAGTATCAGGAGAGCGATTTCGATTTCATCAGCC
GTCTGATGGAACACGAAGGCATCTATTATTATTTCACGCACCAGCAAGACGGCCATACGCTGGTGCTGGC
TGACGCGCCGGCGGCCCATCAGGAACTCGCCGGCTACGCCAGCATTCCCTACCAGCTCGCGGAAGGTGGC
CTGGTGGAAAACAAGGACAGCATCAATAGCTGGAGCGTTTCTGACGCCATCACGCCCAGCCTCTATAGCC
TGGATGACTACGATTTTCGTAAGCCACGCGCGCGGTTGCTGGAGGCCCGGCAGAATCCCGCCTCGTTCGC
GCAGGACAAAGCCGAGGTGTTCGACTGGCCCGGTCGCTATACCGATCACGCCCACGGCCAGTTTTACGTC
AAGGTTCGCCAACAGGAGTTCGAAGCGCAGCACGAGCAGATGAGCGGCGAAGGCAATTCGCAGGGCATTG
CGCCCGGCTACCGTTTTCAACTGACCCAGGCGCCGCGTATGGAAGACAACCGCGCCTACCTGGTGGTCAG
CGCGCAGTACTTCATGCAGGAAAACAGCTACGCCAGCAACGATAATGATGTTGGCGAGCAGCGAACCGAA
TTTCAGGTCGTTCCGGCGGACATCAATTGGCGCCCGGCGCGCACCACGCCTTGGCCGAAAACCCACGGCC
CGCAAACTGCCGAAGTAGTGGGCCCGGAAGGCGAAAGCATCTGGACCGATAAATATGGCCGGGTGAAACT
CAAATTCCGTTGGGATCGCCACGGCAGCGGCAATGAAACCAGTTCCTGTTGGGTGCGCGTCTCGAGCGCC
TGGGCCGGCTGGAAATACGGTGGGATCCAGATCCCGCGCGTGGGTGAGGAAGTGGTGGTCGACTTTATCA
ACGGCGATCCGGATCGCCCTATCATCACCGGCCGCGTTTACAACGAAGACAGCATGCCGCCGTGGGATCT
GCCCGGCGACGCCACTAAAATGGGCTTTATGAGCCGCAGTAAAGGCGGCGGCGCCGACAACGCCAGCTTC
CTGTTCCTGGAAGACTCGCCCGGCAACGAATCGTTCGACATGCATGCCGAACGCAACATGAACATGACGG
TGGAAAACGACAAGAACGTCAATATTGACGGCAGTCGCACCACCACCATCGGGCGCCAGCAGGACGACAC
CGTCACCGGCGACGCCACGTTCCTGTACAAAGCGAAACGCACGACGACCGTCAATGGGCTGGACACCGCC
AACCTGAACGCTCACCAGACGGTGAACATCAAAGGCGGCCGCGACCTGACGATTATCGACGGCGGCGATA
AAATCGACATCACCGGCAATCAGTCTTTCAAGCTTGACGGCGCGCAGACGCAAAACATTACGCAAACCCA
GCATGTCACGGTGAAAGGCAACCAGACCCTCGACATTACCGAAGGGCAACAGACCAGCACCATCAAGCAG
GGGCAGACCGTCAACATCACCGCCGGCGGTCAGCACACCACCATTACTGCCGGCGGGCAAGTCCTGACGA
TTGAAGCGGGCGGCCAGACCGCTACCGTGACCGGGGATGTCACCGAAACCTATAATAATAACCAGAACAC
GACGATCACCGGCACGCTGACCATCAAGGCGAAAACCATTGATATCACCAGTGCGGACGGCGTCTCGGTA
CAAACGCCGAACTGGAAAGATAACTGCCACGGCTGGAAATGGGTGGCGACCGGGGCCAATTTTGCCTTCT
ACGGCTCCAATCTTTCGTTGACGGCGACCAGCCTTAAACACACGATGCTGGATATCTCGCATAACCCGCT
GTCGATCAGCAAAACCAATTTCAAGCTCAGTAATGATCCCATGACGTTCACTCAGCTTGGCGCGCTGGTC
ACCAACGGTGCCTTACGATTGAGCACCAAGGCGCTGGCGATCTTCTTGTAA

Protein ID: 560174119
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2276
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2400742..2402670 [+]
Producttype VI secretion system, effector protein VgrG-like
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.5e-89, Aligned region: 24..331
Protein Sequence: 642 a.a.     [Download]
>gi|560174119|ref|CDG12851.1| type VI secretion system, effector protein VgrG-like [Serratia marcescens subsp. marcescens Db11]
MLDRIIAHTPLGQEQLLFRSLDGIEALSTPFDFSIELLSTDARLDRKALLGQPLTLEIPTQGFLSAPRYL
NGKITAIAVSSEEIGGTRYAVYNLHVQPDLWPMTKDRNFRIFQEQTVPQIVKTLLAEHNVQLEDQLTGDY
RLWGYCVQYNESSFNFISRLMELEGIYYYFKHEMGKHTLVLGDAPHHHQPYPGYEMIPYHLTPSGGSTSE
EGISQWTLSDRVTPGIYSLDDYDFRKPNAWLFQARQNPVSPTPGQIDVYDWPGRYTEHQQGEFYARVRQE
AWQAEHQQIRGTATALGIAPGSTFTLYNAPHADDNREYLTLQANYHLKENRYASGDDQSSEHRIDFIVLP
ADVPWHPPQQATWPKTHGPQTARVVGPAGESIWTDKYGRIKVKFHWDRFGPKDDGSSCWVRVSSAWAGQG
YGGVQIPRVNDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRTKDGTADNANALRFED
KAGAEQVWIQAERNMDTQVKNDESHTIANDHTHLVGGNQIKRVVLNQATGVKGESSALTGKTRSDAVVNA
FTLGSGESLRLECGESVIELLANGQINITGTSFNITVKEDGEINTGGQLDLNQPGGAARTAAPGGGHQAA
IQSAVDQLFPKS
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|560171871|ref|HG326223.1|:2400742-2402670 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGTTGGACCGCATTATTGCGCACACGCCGCTGGGCCAGGAGCAACTGTTGTTCCGCTCACTGGACGGTA
TCGAAGCGCTTTCCACCCCTTTTGACTTCTCTATTGAATTGCTGAGCACCGACGCGCGGCTCGATCGCAA
AGCGCTGCTCGGCCAACCGCTGACGCTGGAGATCCCAACCCAGGGCTTCCTCAGCGCCCCGCGCTACCTG
AACGGCAAGATCACCGCCATCGCCGTCAGCAGCGAAGAGATCGGCGGCACGCGCTACGCGGTGTATAACC
TGCACGTGCAGCCGGATCTCTGGCCGATGACCAAGGACCGCAACTTCCGCATCTTCCAGGAACAGACGGT
GCCGCAGATCGTCAAGACCCTGCTGGCGGAGCACAACGTGCAGCTGGAAGATCAGCTGACCGGCGACTAT
CGCCTGTGGGGCTACTGCGTGCAGTACAACGAAAGCAGTTTCAACTTCATCAGCCGCCTGATGGAGCTGG
AGGGCATCTATTACTATTTCAAACACGAGATGGGCAAACACACGCTGGTGCTCGGGGACGCCCCCCACCA
CCACCAGCCCTATCCCGGCTATGAGATGATCCCCTACCACCTGACGCCGTCCGGCGGCAGCACCAGCGAG
GAAGGCATCAGCCAGTGGACGTTGTCCGATCGCGTCACGCCGGGTATCTACAGCCTGGACGACTACGATT
TCCGCAAGCCGAACGCCTGGCTGTTCCAGGCACGGCAAAACCCGGTCTCGCCGACGCCGGGGCAGATCGA
CGTTTACGACTGGCCGGGCCGCTACACCGAGCATCAGCAGGGGGAGTTCTACGCCCGCGTGCGCCAGGAG
GCCTGGCAGGCCGAACATCAGCAGATCCGCGGTACCGCCACCGCGCTGGGCATTGCTCCCGGCAGCACCT
TTACGCTGTATAACGCCCCGCACGCCGACGACAACCGCGAGTACCTGACGCTGCAGGCCAACTACCATCT
GAAAGAGAACCGCTATGCCAGCGGCGACGATCAGAGCAGCGAACACCGTATCGACTTCATCGTGCTGCCG
GCGGACGTGCCCTGGCACCCGCCGCAGCAGGCCACCTGGCCGAAAACCCACGGGCCGCAGACCGCCCGGG
TGGTCGGCCCGGCCGGCGAATCGATTTGGACCGACAAATACGGCCGTATCAAGGTGAAGTTCCACTGGGA
TCGCTTCGGGCCGAAAGACGACGGCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCCGGCCAAGGC
TACGGCGGCGTGCAGATCCCGCGCGTGAACGACGAAGTGGTGGTGGACTTTATCAACGGCGATCCGGATC
GGCCGATCGTCACCGGGCGCGTCTATAACGAAGCCAGCATGCCGCCTTGGGCGCTGCCGGCCGCCGCCAC
CCAGATGGGCTTTATGAGCCGCACCAAGGACGGCACCGCCGACAACGCCAACGCCCTGCGTTTCGAAGAC
AAGGCCGGCGCCGAACAGGTGTGGATCCAGGCGGAGCGCAACATGGACACCCAGGTGAAAAACGATGAAA
GCCACACCATCGCTAACGACCACACGCATCTGGTGGGCGGCAACCAGATCAAACGGGTGGTGCTCAATCA
GGCAACCGGCGTCAAAGGCGAATCCTCCGCGCTGACCGGCAAAACGCGCAGCGACGCCGTGGTTAACGCC
TTTACCCTCGGCTCCGGCGAATCGCTGCGGCTCGAGTGCGGCGAAAGCGTGATCGAGCTGCTGGCGAACG
GCCAAATCAACATCACCGGCACCAGCTTCAATATCACGGTGAAAGAGGACGGAGAGATCAATACCGGCGG
CCAGCTGGATCTCAACCAGCCTGGCGGCGCCGCGCGCACCGCCGCACCGGGCGGTGGCCATCAGGCGGCA
ATCCAGAGCGCCGTCGATCAGCTGTTCCCGAAATCCTGA