SecReT6
Protein ID: 560174096
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2253
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2374478..2375824 [+]
Producttype VI secretion system-associated protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 448 a.a.     [Download]
>gi|560174096|ref|CDG12828.1| type VI secretion system-associated protein [Serratia marcescens subsp. marcescens Db11]
MKDAHKVVWTEGMFLRPHHFQQAENYLEGYMRNWGQAHSGCFWGFLTLDLDQTLLRQGKIALNAASGIMP
DGTPFRFSGAQQAPAPLTIAENKTGENVVLALPTYRAGREDVIFQESPEALARYLAYENEVDDLNAVSVG
SAALQFGRLRLRLMLESELNAEWTALGVTRVLEKRGDNSLRLDTTQIPPMLNCQGNPVLKTFINDLQGLL
QQRSQQMSQRLLQPGRGGSSEMVDFMLLQLINRHLGQVSHAYHLDHLHPERLFADWLQFATELASFSAQR
TPEGRLPVYDHDNLALCFGKLMLLLRQGLSVVLEDNAIQLTLVERSHGLNVATVQDAKMMRDFGFVLAVR
ADVAAEVLLTHFPAQMKIAPVTRIRDLVQLQLPGIGLRTMPAAPRQIPYHAGYTYFELEKGGDLWKQMEK
SSAFALHLAGEFPGLDMEFWAIRSHTDR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|560171871|ref|HG326223.1|:2374478-2375824 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAAAGATGCTCATAAGGTTGTCTGGACTGAGGGGATGTTTTTGCGCCCTCACCATTTCCAGCAGGCGG
AAAACTATCTCGAAGGCTATATGCGCAACTGGGGCCAGGCCCACAGCGGCTGTTTCTGGGGGTTCCTCAC
CCTGGATCTGGACCAAACGCTGCTGCGCCAGGGCAAGATTGCGCTCAACGCCGCCAGCGGCATCATGCCG
GACGGCACGCCGTTTCGCTTCTCCGGCGCCCAGCAGGCGCCCGCGCCGCTGACCATCGCTGAAAACAAGA
CCGGTGAAAACGTGGTGCTGGCTCTGCCGACCTACCGCGCGGGGCGTGAAGACGTGATCTTTCAGGAAAG
CCCGGAGGCGCTGGCGCGCTATCTGGCTTATGAGAACGAAGTCGACGATCTCAACGCCGTCTCGGTGGGC
AGCGCGGCCTTGCAGTTCGGTCGCCTGCGCCTGCGGCTGATGCTGGAGAGTGAGCTCAACGCCGAATGGA
CGGCGCTCGGCGTTACCCGCGTGCTGGAAAAGCGCGGTGACAACAGCCTGCGTCTCGATACCACGCAGAT
CCCGCCGATGCTGAACTGCCAGGGCAACCCGGTACTGAAAACCTTCATCAACGATCTGCAGGGCCTGCTG
CAACAGCGCAGCCAGCAGATGAGCCAGCGCCTGCTGCAGCCGGGCCGCGGCGGCAGTTCCGAAATGGTCG
ATTTCATGCTGCTGCAGCTGATCAACCGCCATCTCGGCCAGGTGAGCCACGCCTACCACCTCGATCATCT
GCACCCGGAGCGCCTGTTCGCCGATTGGCTGCAGTTCGCCACCGAGCTCGCCAGCTTCTCGGCGCAGCGC
ACCCCGGAAGGCCGCCTGCCGGTGTATGACCACGACAACCTGGCGCTGTGCTTCGGCAAGCTGATGCTGC
TGCTGCGTCAGGGGCTGTCGGTGGTGCTGGAAGACAACGCCATTCAGCTGACGCTGGTCGAACGCTCCCA
CGGGCTGAACGTCGCCACCGTGCAGGACGCCAAAATGATGCGCGATTTTGGCTTCGTTCTGGCAGTGCGC
GCCGACGTGGCCGCCGAGGTGTTGCTGACCCACTTCCCGGCGCAGATGAAGATCGCCCCGGTCACGCGCA
TCCGCGATCTGGTGCAGCTGCAGCTGCCGGGCATCGGTCTGCGCACCATGCCCGCTGCGCCGCGCCAGAT
CCCCTATCACGCCGGCTACACCTACTTCGAGCTGGAAAAAGGCGGCGACCTGTGGAAACAGATGGAGAAA
TCCAGCGCCTTCGCCCTGCACCTGGCCGGCGAATTCCCGGGGCTGGACATGGAATTTTGGGCGATTCGCA
GCCATACGGACCGGTAA