SecReT6
Protein ID: 560174097
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2254
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2375828..2377048 [+]
Producttype VI secretion system-associated protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 406 a.a.     [Download]
>gi|560174097|ref|CDG12829.1| type VI secretion system-associated protein [Serratia marcescens subsp. marcescens Db11]
MTQENSMAPAANPLVDAANPLLNAISQIRQSATHANPAQLRQQLIDEMRRFEIRGQRANLPYEVIIGARY
CLCTALDEAAALTPWGSNSVWSGSGLLVTFHNETWGGEKFFQLLAKLSQSPREHINLLELINYCLLLGFE
GRYRVMENGRSQLETMKQRLLQLIRSVRGGYAPPLSPHALDLPVQQKLWRPLVPLWACVALTGFLASLLF
IALNWRLGDNTSPVLAAIYQTNLPQVAIGNPAPAAPPTLSLKSFLRKEIAEGLVVVRDEAQQSVVILKGD
GLFDSAATTVRANYIPVIDRIAAAMNGVSGKILVTGYSDNVPIRSARFASNWELSLARAEAVSARLQKHL
ANPQRVKAEGRGESNPVAPNDNKVNRALNRRVEITLLVAPENTQAEINGLPQGTGK
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|560171871|ref|HG326223.1|:2375828-2377048 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGACTCAGGAAAATAGCATGGCGCCGGCGGCCAACCCGCTGGTAGACGCCGCCAACCCGCTGCTGAACG
CCATTTCGCAGATCCGCCAATCGGCCACGCACGCCAACCCGGCGCAGCTGCGCCAACAGCTGATTGACGA
AATGCGCCGCTTCGAGATCCGCGGCCAACGCGCCAACCTGCCTTACGAGGTGATCATCGGCGCGCGTTAT
TGTCTGTGCACCGCGCTGGATGAAGCGGCGGCGCTGACCCCGTGGGGCAGCAACAGCGTGTGGTCCGGCA
GCGGGCTGCTGGTGACTTTCCATAACGAAACCTGGGGCGGCGAGAAGTTTTTCCAGCTGCTGGCCAAGCT
GTCGCAAAGCCCGCGCGAGCACATCAACCTGCTGGAACTGATCAATTATTGCCTGCTGTTGGGCTTTGAA
GGCCGCTACCGGGTGATGGAAAACGGCCGCTCACAGCTGGAAACCATGAAGCAGCGCCTGCTGCAACTGA
TCCGATCGGTGCGTGGCGGCTATGCCCCGCCGCTGTCGCCTCATGCGCTGGATCTGCCGGTACAGCAGAA
GCTGTGGCGGCCGCTGGTGCCGCTGTGGGCCTGCGTGGCGCTGACCGGCTTCCTGGCTTCGCTGCTGTTC
ATCGCCCTCAACTGGCGACTGGGCGACAACACCAGCCCGGTGCTGGCGGCGATTTACCAAACCAATCTGC
CGCAGGTGGCGATCGGTAACCCGGCGCCGGCTGCGCCGCCGACGCTGAGCCTGAAAAGTTTCCTGCGCAA
AGAGATCGCCGAGGGGTTGGTGGTGGTGCGCGACGAAGCGCAGCAAAGCGTGGTGATCCTCAAAGGCGAC
GGGCTGTTCGACTCTGCCGCCACCACGGTACGCGCCAACTATATTCCGGTCATCGACCGCATCGCCGCCG
CCATGAACGGCGTCAGCGGCAAGATCCTGGTCACCGGCTACAGCGACAACGTGCCGATCCGCAGCGCCCG
TTTCGCCTCCAACTGGGAGCTGTCGCTGGCGCGCGCCGAAGCGGTCAGCGCCCGCTTGCAAAAACACCTC
GCCAACCCGCAGCGGGTCAAGGCCGAGGGCCGCGGCGAGAGCAACCCCGTCGCGCCGAACGATAACAAAG
TGAACCGCGCGTTGAACCGCCGGGTAGAAATTACGCTGTTGGTCGCCCCTGAAAATACCCAGGCGGAAAT
CAACGGCTTGCCGCAAGGAACCGGAAAGTAA