SecReT6
Protein ID: 560174098
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2255
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2377048..2380683 [+]
Producttype VI secretion system-associated protein,IcmF-like
NoteTssM
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1211 a.a.     [Download]
>gi|560174098|ref|CDG12830.1| type VI secretion system-associated protein,IcmF-like [Serratia marcescens subsp. marcescens Db11]
MLSTLFSIITSRLLWGFVGITALAFIIWTIGPLVAIGDYRPLEPELNRQIAIGVIYLIWFLCRLIPRLYS
AWFNSRLLSNLRAAEAVPAEDGKPEVKQDDQLAQRFDEAAQLLKKARFAPGQGDGKHRWMTRFSRQYLYQ
LPWYVIIGAPGAGKTTALVNSGLHFPLADRFGKAALRGVGGTRNCDWWFTNDAVLLDTAGRYTTQESQRE
EDAGEWQSFVALLKKYRTRQPINGVMVTISVADLLSDSAEARAAQASALRKRLIELHEQLGIHFPVYVLV
TKTDLLNGFMAYFGSFDKAQRDQIWGFTFPYERSRQPDFNLNAAFEQQYALLQQRLDAALPDTLLMEHDA
RQRAESYLFPQEFAALRPLLGQYLEQVFATSSFETRFTPRGIYFTSGTQEGLPFDRVMGELNRYLQLPTA
NSGVQANAAWDSVGQETPIPAAKGQSFFLKETLESVVFQESGLAGSNRWWEYRNRALHWAGYIALAVILA
VLAMLWFTSYGNNKAYLAEVAAKVPGVERQGQSLTQLGNGDMFSLLPFLNSLLHLPDSQNFSLDDPPFTY
RMGLFRGDQVGDAGNALYQKALKELLLPQVAQQIATTLRNDNHGDADFSYEALKAYQMLYLPKQYDGKFL
RAWVMLNLQRNLPQGSTQKQLQQIEWHLSQLLDAQIQASPYAKDEQLVAQAQAALNRAPLSQRVYGRLKR
LLLKQTDIKPVSLVDLAGPQTELAFSRKSGKPVTDGVPGLFTSQGYWKAFNDNIDPVTDTLRKEDVWVLN
SQTPEQKSADLTKTIRQLYMQDFISAWDELLGDIQLANIGNLTQRISSARLLSGNPSPMRNLLVNVSKNV
TLRDEKNDADSRSLLAKTEDKLNQNANRTLEALFTNRPANADGDVSAQPEQLVMAHFAPLLELAQSQGEG
NKAIPFDSVLKQVDELYSYLTAVQGAANSGMSAPPSDIIPRLQAESGRLPVPFKQMLLSLAIGASSDTQR
KEMENVKKRISFEVGSFCRQAIAGRYPLVARARQEVTPDDLARMFAPNSGLMDSFFRDNLQGKVDTTRAN
WRFTPGVDGKTLPGGEGILRSFQQAQRIRDAFFANGTATPSYRVTVRPVRMDNDILNLTLDIDGQLFKYS
HGPQVPLVVSWPGTRNTNQVHLQLALANGTTASLVTSGPWALNRLVDMAQSSGTGGLGRQATFNLDGHRV
TLEFTPNSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3636 bp     [Download]
>gi|560171871|ref|HG326223.1|:2377048-2380683 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGCTCAGTACGTTATTCTCCATCATCACCAGCCGCCTGCTGTGGGGCTTTGTCGGCATCACCGCGCTGG
CGTTCATCATCTGGACGATCGGCCCGCTGGTGGCCATCGGCGACTATCGCCCGCTGGAGCCGGAACTCAA
CCGCCAGATCGCCATCGGCGTGATTTACTTGATCTGGTTCCTGTGCCGCCTGATCCCGCGCCTCTACAGT
GCCTGGTTCAACAGCCGCCTGCTGAGCAATCTGCGCGCCGCCGAAGCGGTGCCGGCGGAAGACGGCAAGC
CCGAGGTCAAACAAGACGATCAGTTGGCGCAGCGTTTCGACGAAGCGGCGCAGCTGCTGAAAAAGGCGCG
CTTCGCACCGGGCCAGGGCGACGGTAAACATCGCTGGATGACCCGCTTCAGCCGTCAATATCTGTACCAG
TTGCCGTGGTATGTGATCATCGGCGCACCCGGCGCCGGCAAAACCACCGCGCTGGTCAACTCCGGCCTGC
ACTTCCCACTGGCGGATCGCTTCGGCAAAGCCGCGCTGCGCGGCGTGGGCGGCACCCGCAACTGCGACTG
GTGGTTTACCAACGACGCCGTGCTGCTCGACACCGCCGGCCGCTACACCACCCAGGAAAGCCAGCGCGAA
GAAGACGCCGGTGAATGGCAAAGCTTCGTCGCGCTGCTGAAAAAATACCGCACCCGCCAGCCGATCAACG
GCGTGATGGTGACCATCAGCGTCGCCGATCTGCTGAGCGACAGCGCCGAAGCACGCGCCGCCCAGGCCAG
CGCACTGCGCAAACGCCTGATTGAACTGCACGAACAGTTGGGCATTCACTTCCCGGTCTATGTGCTGGTG
ACCAAAACCGACCTGCTCAACGGCTTTATGGCCTACTTCGGCAGCTTCGACAAAGCGCAGCGCGACCAGA
TCTGGGGATTCACCTTCCCTTACGAGCGCTCACGGCAGCCGGACTTCAACCTGAACGCCGCCTTCGAACA
ACAATACGCCCTGCTGCAACAACGGCTGGATGCGGCGCTGCCGGATACGCTGCTGATGGAGCACGACGCG
CGCCAACGCGCCGAAAGCTACCTGTTCCCGCAGGAGTTCGCCGCGCTGCGCCCGCTGCTCGGCCAATATC
TGGAACAGGTGTTCGCCACCTCCAGTTTTGAAACCCGCTTTACCCCGCGCGGCATCTATTTCACCAGCGG
CACGCAGGAAGGTCTGCCGTTTGACCGGGTGATGGGCGAACTGAACCGCTACCTGCAGCTGCCGACGGCC
AACTCAGGGGTGCAGGCCAACGCGGCCTGGGACAGCGTGGGGCAGGAAACGCCGATCCCGGCAGCCAAAG
GCCAGAGCTTCTTCCTGAAAGAGACGCTGGAATCGGTGGTCTTCCAGGAGTCCGGGCTGGCGGGCAGCAA
CCGCTGGTGGGAATACCGCAACCGCGCCCTGCACTGGGCAGGGTACATCGCGCTGGCGGTGATCCTGGCG
GTGCTGGCGATGTTGTGGTTCACCAGCTACGGCAACAACAAGGCCTATCTGGCGGAAGTGGCCGCCAAGG
TGCCCGGCGTCGAGCGACAGGGGCAAAGCCTGACCCAGTTGGGCAACGGCGACATGTTCTCGCTGCTGCC
GTTCCTCAACAGCCTGCTGCATCTGCCGGACAGCCAGAACTTTTCGCTGGACGATCCGCCGTTCACCTAC
CGCATGGGGCTGTTCCGCGGCGATCAGGTGGGCGACGCCGGCAATGCGTTGTACCAAAAAGCGCTGAAAG
AGCTGCTGCTGCCGCAGGTGGCGCAACAGATCGCCACCACGCTGCGCAACGACAACCACGGCGACGCGGA
CTTCAGCTACGAAGCGCTGAAGGCCTATCAGATGCTGTATCTGCCAAAGCAGTACGACGGTAAATTCCTG
CGCGCCTGGGTGATGCTCAACCTGCAACGCAACCTGCCGCAGGGCAGCACGCAGAAACAGCTGCAGCAGA
TCGAATGGCACCTCAGCCAACTGCTGGATGCGCAGATCCAGGCCTCGCCTTACGCCAAAGACGAACAGCT
GGTGGCGCAGGCGCAGGCCGCACTCAATCGGGCGCCGCTGTCGCAGCGCGTCTATGGCCGCCTCAAGCGC
CTGCTGCTGAAACAGACCGACATCAAGCCGGTCAGCCTGGTCGATTTGGCCGGCCCGCAGACCGAACTGG
CGTTCAGCCGCAAAAGCGGCAAACCGGTCACCGACGGCGTACCGGGCCTGTTCACCTCACAAGGGTACTG
GAAAGCGTTCAACGACAACATCGACCCGGTGACCGACACCTTGCGCAAGGAAGACGTCTGGGTGTTGAAC
AGCCAGACGCCGGAGCAGAAAAGCGCCGATCTGACCAAGACCATCCGCCAGCTGTACATGCAAGATTTCA
TCAGCGCCTGGGATGAGCTGCTGGGGGATATCCAACTGGCCAACATCGGCAACCTGACCCAGCGCATCAG
CAGCGCGCGCCTGCTGTCCGGCAACCCGTCGCCAATGCGCAATCTGCTGGTCAACGTCAGCAAAAACGTC
ACCCTGCGCGACGAAAAAAACGACGCCGATTCGCGCTCGCTGCTGGCAAAAACCGAAGATAAGCTGAACC
AAAATGCCAACCGCACGCTGGAAGCGCTGTTCACCAACCGGCCGGCCAACGCCGACGGTGACGTGTCGGC
CCAGCCGGAACAGCTGGTGATGGCGCACTTCGCGCCGCTGCTGGAGCTGGCGCAAAGCCAGGGCGAAGGC
AATAAGGCGATCCCTTTCGACAGCGTGCTGAAACAGGTCGATGAACTGTACAGTTACCTGACGGCGGTGC
AGGGCGCGGCCAACAGCGGCATGTCGGCGCCGCCGAGCGACATTATCCCGCGTCTGCAGGCCGAATCCGG
CCGCTTGCCGGTGCCGTTCAAACAGATGCTGCTGTCGCTGGCGATCGGCGCCAGCAGCGATACCCAGCGC
AAAGAGATGGAGAACGTGAAAAAGCGCATCAGCTTCGAGGTCGGTAGCTTCTGCCGCCAGGCGATCGCCG
GCCGTTATCCGCTGGTGGCCCGGGCGCGGCAGGAAGTGACGCCGGACGATCTGGCGCGCATGTTCGCGCC
GAACAGCGGGCTGATGGACAGCTTCTTCCGCGACAATCTGCAGGGCAAGGTCGATACCACCCGCGCCAAC
TGGCGTTTCACGCCCGGCGTGGACGGCAAGACGCTGCCCGGCGGCGAAGGCATCCTGCGGTCGTTCCAGC
AGGCGCAGCGCATCCGCGACGCCTTTTTCGCCAACGGCACGGCGACGCCCTCCTACCGCGTGACCGTGCG
GCCGGTGCGGATGGATAACGACATCCTCAACCTGACGCTGGATATCGACGGGCAGCTGTTCAAATACAGC
CACGGCCCACAGGTACCGCTGGTGGTCAGTTGGCCGGGCACCCGCAATACCAACCAGGTGCATCTGCAGC
TGGCGCTGGCCAACGGCACCACCGCCAGCCTGGTGACCAGCGGACCATGGGCGCTGAATCGCCTGGTCGA
CATGGCGCAATCGTCGGGCACCGGCGGCCTCGGCCGCCAGGCGACGTTCAATCTCGACGGCCACCGCGTC
ACGCTGGAGTTCACGCCCAACAGCATCCGCAATCCGTTCCAACTGCCGGCCTTCTCGTGCCCGTAG