SecReT6
Protein ID: 560174100
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2257
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2381445..2382476 [+]
Producttype VI secretion system-associated protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 343 a.a.     [Download]
>gi|560174100|ref|CDG12832.1| type VI secretion system-associated protein [Serratia marcescens subsp. marcescens Db11]
MAIDTDTLLAPVDADNPCGDNLEYDADFLAMEQAATGKAEQQFGSTIIPEEAPDWVQVERLATSLLTRTK
DLRIMLYLTRAWTQLRGLPGYADGLTLVHQSMTRYWNTLQPPLEFDGEADPLFRINALADLGDKAALAAS
VRAAPLLKSAAGEISLRDAGALLDGSKQECPNFPGGRARLQDELAQQDRPEGALVTRIANTLSAIRSEVT
RHLGESALPEMSALTKVFSLVALAGQSDAPAADEPDATPEAAAMQQPAAVQSATAPLNWRSAQIQSRDDA
QLMLDKVKNYFRLHEPSHPAPLMIDRVQRLITLDFMQIVRDLAPDGLNQLETILGRPDNEENS
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|560171871|ref|HG326223.1|:2381445-2382476 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGGCTATCGATACCGATACCCTGCTGGCCCCGGTTGACGCGGACAATCCCTGCGGCGACAACCTGGAAT
ACGACGCCGACTTTCTGGCGATGGAACAAGCCGCCACCGGCAAGGCCGAACAACAGTTCGGCAGCACCAT
CATTCCGGAAGAAGCGCCGGATTGGGTGCAGGTCGAGCGCCTCGCGACCTCGCTGCTAACGCGCACCAAA
GACCTGCGCATCATGCTGTATCTCACCCGCGCCTGGACCCAGCTGCGCGGGTTGCCGGGCTACGCCGACG
GGCTGACGCTGGTCCACCAGTCGATGACCCGTTACTGGAACACCCTGCAGCCGCCGCTGGAGTTCGATGG
GGAAGCCGACCCGCTGTTTCGCATCAACGCGCTGGCCGACCTTGGCGACAAAGCGGCGCTGGCCGCCAGC
GTACGCGCCGCGCCGCTGCTGAAAAGCGCCGCCGGAGAAATCTCGCTGCGCGATGCCGGCGCCCTGCTCG
ACGGCAGCAAACAGGAGTGCCCCAACTTTCCCGGCGGCCGTGCGCGGCTGCAGGATGAACTGGCGCAGCA
GGATCGCCCCGAAGGCGCCCTGGTGACGCGCATCGCCAACACCCTGAGCGCCATTCGCAGCGAAGTGACC
CGCCATCTGGGGGAAAGCGCGCTGCCGGAAATGAGCGCGCTGACCAAGGTGTTTTCTCTGGTGGCGCTCG
CCGGCCAGAGCGATGCCCCGGCCGCCGACGAACCAGACGCGACGCCTGAAGCGGCTGCCATGCAGCAACC
GGCCGCCGTACAGAGCGCCACCGCTCCACTCAACTGGCGCAGCGCGCAGATCCAGTCGCGCGACGACGCC
CAGTTGATGCTGGACAAGGTGAAAAACTATTTTCGTCTTCATGAACCGAGCCACCCGGCGCCACTGATGA
TCGATCGAGTCCAGCGACTGATTACGCTGGACTTTATGCAAATCGTCCGCGATTTGGCGCCCGATGGGCT
TAACCAACTGGAGACCATTCTCGGTCGCCCCGACAACGAGGAGAACAGCTAG