SecReT6
Protein ID: 560174101
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2258
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2382597..2383133 [+]
Producttype VI secretion system-associated protein
NoteTssB
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 178 a.a.     [Download]
>gi|560174101|ref|CDG12833.1| type VI secretion system-associated protein [Serratia marcescens subsp. marcescens Db11]
MSNSKSRSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKAVDPQASVEERKFMEIDVD
NFDERMKSLKPRVAYQVDNTLTGEGKLNIDLTFESMEDFSPAAIARKVDALDNLLDARTQLSNLLSYMDG
KNGAEELISKILQNPALLQSLTDAPKPAVNDDNNERED
 
Nucleotide Sequence: 537 bp     [Download]
>gi|560171871|ref|HG326223.1|:2382597-2383133 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGTCAAACTCGAAATCCCGCAGCGGGCAGAAATTCATCGCCCGCAACCGCGCGCCGCGCGTACAGATTG
AATACGATGTCGAAATTTATGGCGCAGAGCGCAAAATCCAGCTGCCGTTCGTGATGGGCGTGATGGCGGA
TCTGGTGGGGAAAGCGGTCGACCCGCAAGCCAGCGTGGAAGAGCGCAAATTCATGGAAATCGACGTCGAC
AACTTCGACGAGCGTATGAAATCGCTGAAGCCGCGCGTCGCTTACCAGGTCGACAACACCCTGACCGGCG
AAGGCAAGCTGAACATCGATCTGACCTTCGAAAGCATGGAAGACTTCTCCCCCGCCGCTATCGCCCGCAA
GGTCGACGCGCTGGACAATCTGCTGGACGCCCGCACCCAGCTTTCCAACCTGCTGTCCTACATGGACGGC
AAGAACGGCGCCGAAGAGCTGATCTCCAAGATCCTGCAAAACCCGGCGCTGCTGCAATCCCTGACCGACG
CGCCGAAGCCGGCGGTTAACGACGACAACAACGAGCGTGAGGATTAA