SecReT6
Protein ID: 560174106
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2263
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2386232..2386714 [+]
Producttype VI secretion system, effector protein Hcp-like
NoteTssD
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS_HCP [PF05638], Evalue: 8.1e-38, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|560174106|ref|CDG12838.1| type VI secretion system, effector protein Hcp-like [Serratia marcescens subsp. marcescens Db11]
MAIDMFLKVEGASGESKDSNHKGWTDITSFSWGASQPGNMGVGGGGGAGKVCFNDLHVNALVDKSTPALL
KHCSSGKHLTKVELSVCKAGGTQVEYVKITLDDVLVTAVQYTGAGGEDTVGVTYSFQAAKVKQQYWEQSD
KGGKGAESSAGWNIKENREA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|560171871|ref|HG326223.1|:2386232-2386714 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGGCTATTGATATGTTCCTGAAAGTTGAAGGTGCCAGCGGCGAATCCAAAGATTCGAATCACAAAGGCT
GGACCGACATTACTTCTTTCTCCTGGGGCGCTTCTCAACCGGGCAATATGGGCGTTGGCGGCGGCGGTGG
CGCCGGCAAAGTGTGCTTCAACGATCTGCACGTTAACGCGCTGGTCGACAAGTCAACCCCGGCGCTGCTG
AAGCACTGCTCCAGCGGTAAGCACCTGACCAAGGTTGAGTTGTCTGTCTGCAAGGCGGGCGGTACTCAGG
TTGAGTACGTTAAAATCACCCTGGACGACGTGCTGGTCACCGCCGTGCAGTACACCGGCGCAGGCGGCGA
AGACACCGTGGGCGTCACCTACTCCTTCCAGGCGGCGAAAGTGAAACAGCAATACTGGGAGCAGAGCGAC
AAAGGCGGCAAAGGCGCCGAAAGCAGCGCAGGTTGGAACATCAAGGAAAACCGCGAAGCTTAA