SecReT6
Protein ID: 560174114
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2271
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2392860..2393435 [+]
Producttype VI secretion system,lysozyme-relatedprotein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 191 a.a.     [Download]
>gi|560174114|ref|CDG12846.1| type VI secretion system,lysozyme-relatedprotein [Serratia marcescens subsp. marcescens Db11]
MNDKRPPHYDGGDLRRQGYRNRQDSERLTSRDKMQPVLLDMLTDDEPQKKQEEQVRNLVSHSELRRRVLR
DLQWLFNCVNSESNLDLGDFPQVRRSTLNYGIASLAGKRMSDIEWLDIQRALTDSILHFEPRILPEGLQV
RCISDTGSLELHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFDLKDIG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|560171871|ref|HG326223.1|:2392860-2393435 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGAACGATAAACGCCCACCCCACTACGACGGCGGCGATCTGCGCCGCCAGGGCTATCGCAATCGTCAGG
ACAGCGAGCGCCTGACGTCGCGCGACAAAATGCAGCCGGTGCTGCTCGACATGCTGACCGACGACGAACC
GCAGAAAAAACAGGAGGAGCAGGTGCGCAACCTGGTGTCGCACAGCGAGCTGCGCCGCCGGGTATTGCGC
GATTTGCAGTGGCTGTTCAACTGCGTCAACAGCGAATCCAATCTGGATCTCGGCGATTTTCCACAGGTGC
GGCGCTCCACCCTGAATTACGGCATCGCCTCGCTGGCGGGCAAGCGCATGTCGGACATCGAATGGCTGGA
CATTCAGCGCGCGCTGACCGATTCCATCCTCCATTTCGAACCGCGCATTCTGCCCGAAGGACTGCAGGTG
CGCTGCATCTCGGACACCGGCTCGCTGGAACTGCACAACGTGCTGTCGATCGAAATCAAGGGCCGCCTGT
GGTGCGTGCCCTATCCGCTGGAGTTTCTGTTCCGTACCGACGTGGATCTGGAAAACGGCCACTTCGATCT
GAAAGACATAGGGTAA