SecReT6
Protein ID: 560174115
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2272
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2393440..2395326 [+]
Producttype VI secretion system-associated protein
NoteTssF
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 628 a.a.     [Download]
>gi|560174115|ref|CDG12847.1| type VI secretion system-associated protein [Serratia marcescens subsp. marcescens Db11]
MDSKLLDYYNRELAYLREMGAEFAEQYPKVAGRLGMRGIDVADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEIIYPNYLSPTPSMAIAELQPDSSKGDISNGFVVPRGTMMDSQTLKKSGITCSYTTAHDVTLQP
VRIAGVELGGIPADIPLASLGLQHSGCVSALRIRLECYESVTLNNLQLDQLMFYLAGPDMQAQQLLELLM
QHSVGLVCQTVEAQPQRRALALDGLRQEGFAAEQALLPNDLRNFEGYRLLQEYFAFPARFQFFSVNGLRP
LLQSVREGKKALRQFEIVVLLDRHDAALERVVDVAHLALHCTPVINLFPKIAERIAINEKNHEYHLVVDN
IRPLDYEVFSVQRLGGSASEKRYEQEFRPFYSTLSADDGNYGAYFSLRREQRTLSEHARRYGTRTGYAGS
EVFVSLVDERQSPWHSDLKYLTADVLCTSRDLPLMLLQQDQGNFVMPDSIPIKQVSLRKGPTPPRPALAE
GMITWRLISQLQLNYLSMMDGDPEQGAASLRQLLGLYGNLSEPAIAKQIQGVRHCNLRPVYRRVPEPGPI
VFARGIAIDLTVDEQAFSGNSPYLLGSVLERLFSRLVAMNTFTEMTLSSQQRGEIAYWQARMGKRTLI
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|560171871|ref|HG326223.1|:2393440-2395326 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGGACAGTAAACTGTTAGATTATTACAACCGCGAGCTGGCCTATCTGCGTGAGATGGGCGCCGAGTTCG
CCGAACAGTACCCGAAGGTCGCGGGCCGTCTCGGCATGCGCGGCATCGACGTGGCGGACCCTTATATCGA
GCGCCTGATGGAGGGCTTCGCCTTCCTCACCTCGCGCGTGCAGCTGAAAATGGACGCCGAGTTCCCGCGC
TTTTCTCAGCGCTTGCTGGAGATCATCTACCCCAATTACCTGTCGCCGACGCCGTCGATGGCGATCGCCG
AGCTGCAGCCGGACAGCAGCAAAGGCGACATCAGCAACGGCTTCGTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGACGCTGAAGAAAAGCGGCATCACCTGCAGCTACACCACCGCCCATGACGTCACGCTGCAGCCG
GTGCGCATCGCCGGCGTCGAGCTGGGCGGCATTCCGGCCGATATTCCGCTGGCCTCGTTGGGGCTGCAGC
ACAGCGGCTGCGTCAGCGCGCTGCGCATTCGTCTCGAGTGCTACGAAAGCGTGACGCTCAACAACCTGCA
GCTGGATCAATTGATGTTTTACCTGGCCGGGCCGGACATGCAGGCGCAGCAGCTGCTGGAACTGCTGATG
CAGCACAGCGTCGGGCTTGTCTGCCAAACGGTGGAGGCGCAACCGCAGCGGCGGGCGCTGGCGCTGGACG
GGCTGCGGCAGGAGGGCTTCGCCGCCGAGCAGGCGCTGCTGCCCAACGACCTGCGCAACTTTGAAGGCTA
CCGGCTGCTGCAGGAGTATTTCGCCTTCCCGGCGCGCTTCCAGTTTTTCAGCGTCAACGGCCTGCGTCCG
CTGCTGCAGAGCGTGCGCGAAGGGAAAAAAGCGCTGCGCCAGTTCGAGATCGTGGTGCTGCTGGATCGGC
ACGACGCCGCGCTAGAACGGGTGGTCGACGTTGCCCATTTGGCGCTGCACTGCACGCCGGTGATCAACCT
GTTTCCGAAGATCGCCGAACGCATCGCGATCAACGAAAAAAACCACGAATACCATCTGGTGGTCGACAAT
ATCCGGCCGCTGGATTACGAAGTGTTCTCGGTGCAGCGGCTCGGCGGCAGCGCCAGCGAAAAACGCTACG
AGCAAGAGTTTCGGCCGTTTTACAGCACCCTGAGCGCGGACGACGGCAACTATGGCGCCTACTTCTCGCT
GCGGCGCGAACAGCGCACCCTGTCGGAACACGCCCGCCGCTATGGCACCCGCACCGGCTATGCCGGTTCG
GAAGTGTTCGTATCGCTGGTGGACGAACGGCAATCGCCGTGGCACAGCGATCTGAAATACCTCACCGCCG
ACGTGTTGTGCACCAGCCGCGACCTGCCGTTGATGTTGCTGCAGCAGGATCAGGGCAACTTCGTGATGCC
CGATTCAATCCCGATCAAGCAGGTCTCGCTGCGCAAAGGCCCCACCCCGCCACGCCCGGCGCTGGCCGAA
GGGATGATCACCTGGCGGTTGATCAGTCAGCTGCAGCTGAATTACCTCAGCATGATGGACGGCGATCCGG
AACAGGGCGCCGCCAGCCTGCGCCAGTTGCTGGGGCTGTATGGCAACCTGAGCGAGCCGGCGATCGCCAA
ACAGATCCAGGGCGTGCGCCACTGCAACCTGCGGCCGGTCTATCGGCGAGTGCCTGAACCCGGCCCCATC
GTGTTCGCGCGCGGCATCGCCATCGATCTGACGGTCGATGAGCAGGCGTTCTCGGGCAACAGCCCTTACC
TGCTCGGCAGCGTGCTGGAGCGCCTGTTCTCGCGCCTGGTGGCGATGAACACCTTCACCGAGATGACGCT
CTCCAGCCAGCAACGCGGCGAAATCGCCTACTGGCAGGCGCGCATGGGCAAAAGGACGCTGATATGA