SecReT6
Protein ID: 560174117
SecReT6 ID929
T6SS typeN/A
Gene symbol-
Locus tagSMDB11_2274
StrainSerratia marcescens Db10
RepliconT6SS [GenBank: HG326223] [Browse all T6SS(s) in this replicon]
Location [Strand]2396450..2399104 [+]
Producttype VI secretion system ATPase, ClpV1-like
NoteTssH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 884 a.a.     [Download]
>gi|560174117|ref|CDG12849.1| type VI secretion system ATPase, ClpV1-like [Serratia marcescens subsp. marcescens Db11]
MSEISRSVLFGKLDSLLFTSLESATAFCKLRGNPYVELAHWLHQLMQSPDGDLQQIVRHFALDEAQLARD
IVEALDRLPRGASAISDLSEHIDSAVERAWVYGSLKFGAARIRGGHLLLGILKTYSLRHLLKAISPQFER
INADLLMDQFAAITAHSAENAQDAPAESGAENVSGAPRSGESVLAQYAQDLTARARNGEIDPVAGRDEEI
RQIIDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIVAGDVPPQLRDVKLCLLDIGMLQAGAGVKGEFEK
RLQAVIDEVQSSPTPIILFIDEIHTLIGAGGTQGTGDAANLLKPALARGQLRTVGATTWSEYKKYIEKDP
ALTRRFQVVQVHEPSEDKALLMLRSTVSPLEQHHRVLLLDEAVDAAVRLSHRYIPARQLPDKAVALLDTA
CARVAVSQHAEPAQVEDCRHRIDALQIELDIARREAKVGIGDPLRPQEIETQLTALRQALEQLTDRWQQE
LALIQEIITLRAQLHQQEAEPTGEETEAAPDADALRAQLGELQQQLNALQGEAPLIFAAVDANIVAAVVA
DWTGIPLGRMVKNEIEAVLQLSDTLNQRVIGQRHALDLIARRVRTSRARLDDPNKPVGVFLLAGPSGVGK
TETALALAETLYGGEQNVITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEK
AHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTIIILTSNVGTDLIAGLCSDPELLPEPEALSGALRQPLLS
VFPAALLGRLLVVPYYPLTDATLGNIVRLQLGRIQRRLAENHDIVCTFDDAVIEQIVSRCSEVESGGRMV
DAILTNTLLPQISHTLLTGSANDQRYRQLHIALQNHEFICQFQA
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|560171871|ref|HG326223.1|:2396450-2399104 Serratia marcescens subsp. marcescens Db11 chromosome, complete genome
ATGTCTGAAATCAGCCGCTCGGTATTATTTGGCAAACTGGATAGCCTGTTATTCACCTCTCTGGAAAGTG
CGACGGCGTTTTGCAAGCTGCGCGGTAACCCCTACGTCGAACTGGCGCACTGGCTGCATCAGCTGATGCA
ATCGCCGGACGGCGATCTGCAGCAAATCGTTCGCCACTTCGCGCTGGACGAGGCGCAACTGGCGCGCGAC
ATCGTCGAGGCGCTCGATCGCCTGCCGCGCGGCGCCAGCGCCATTTCCGATCTGTCCGAGCACATCGACA
GCGCGGTAGAACGCGCCTGGGTCTATGGCTCATTGAAATTCGGCGCGGCGCGCATCCGCGGCGGCCACCT
GCTGCTCGGTATCCTGAAAACCTACAGCCTGCGCCATCTGCTGAAGGCCATTTCCCCGCAGTTCGAGCGC
ATCAACGCCGATCTGTTGATGGATCAGTTCGCCGCCATCACCGCTCACTCGGCGGAAAACGCCCAGGATG
CGCCGGCGGAAAGCGGCGCCGAGAACGTATCCGGCGCGCCGCGCAGCGGTGAAAGCGTGCTGGCGCAGTA
TGCCCAGGATCTGACCGCCAGAGCGCGCAACGGCGAGATCGACCCGGTGGCCGGCCGCGATGAGGAAATC
CGGCAAATCATCGATATCCTGATGCGCCGCCGCCAGAACAACCCGCTGCTGACCGGCGAGGCGGGCGTCG
GCAAAACCGCGGTGGTGGAAGGCCTGGCGCTGCGCATCGTGGCCGGCGACGTACCGCCGCAGCTGCGCGA
CGTGAAACTGTGCCTGTTGGACATCGGCATGCTGCAGGCCGGCGCCGGCGTCAAAGGCGAGTTTGAAAAA
CGGCTGCAGGCGGTGATCGACGAAGTGCAGTCCAGCCCGACGCCGATCATCCTGTTTATCGACGAAATTC
ACACCCTGATCGGCGCCGGCGGCACCCAGGGCACCGGCGACGCCGCCAACCTGCTGAAACCGGCGCTGGC
GCGTGGCCAACTGCGCACTGTCGGCGCCACCACCTGGTCGGAATACAAGAAATACATCGAGAAAGACCCG
GCGCTCACCCGCCGTTTCCAGGTGGTGCAGGTGCACGAGCCAAGCGAAGACAAGGCGCTGCTGATGCTGC
GCAGCACCGTCAGTCCGCTGGAACAACACCACCGCGTGCTGCTGCTGGATGAAGCGGTGGACGCCGCGGT
GCGGCTGTCGCATCGCTATATTCCTGCCCGCCAGCTGCCGGACAAAGCGGTGGCGCTGTTGGATACCGCC
TGCGCGCGCGTGGCGGTCAGCCAACACGCCGAGCCTGCCCAGGTCGAAGACTGCCGCCACCGCATCGATG
CGCTGCAGATAGAGTTGGATATCGCCCGCCGCGAGGCCAAAGTCGGCATTGGCGATCCCCTGCGCCCGCA
GGAAATTGAAACCCAGCTGACCGCGCTGCGCCAGGCGTTGGAACAGCTGACCGACCGCTGGCAGCAGGAG
CTGGCGCTGATCCAAGAGATCATCACGCTACGCGCCCAGTTGCACCAGCAGGAAGCGGAGCCTACCGGCG
AAGAAACAGAGGCGGCCCCTGACGCCGACGCGCTGCGCGCCCAGCTGGGCGAACTTCAGCAGCAGCTGAA
CGCGCTGCAGGGCGAGGCGCCGCTGATCTTCGCCGCCGTCGACGCCAACATCGTGGCGGCGGTAGTGGCC
GACTGGACCGGCATCCCGCTGGGCCGCATGGTGAAAAACGAGATTGAGGCGGTGCTGCAGCTCTCCGACA
CCCTGAACCAGCGCGTGATCGGCCAACGCCATGCGCTGGATCTGATCGCCCGCCGGGTGCGCACTTCGCG
GGCGCGGCTGGACGATCCGAACAAGCCGGTCGGGGTGTTCCTGCTGGCCGGGCCGTCCGGCGTCGGCAAG
ACCGAAACCGCGCTGGCGCTGGCGGAAACCCTGTACGGCGGCGAGCAGAACGTCATCACCATCAACATGA
GCGAATTCCAGGAGTCGCACACCGTTTCGACGCTCAAAGGCGCGCCCCCCGGCTATGTCGGCTACGGCGA
AGGCGGCGTGCTGACCGAGGCGGTGCGCCGCCGCCCTTACAGCGTGGTGCTGTTGGACGAGATCGAGAAG
GCGCACCCGGACGTGCATGAGATCTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAGGACGGCGAAGGCC
GCCATATCGATTTCCGCAACACCATTATCATCCTGACCTCCAACGTCGGCACCGATCTGATCGCCGGGCT
GTGCAGCGATCCGGAGCTGCTGCCGGAGCCGGAGGCGCTGAGCGGCGCGCTGCGCCAGCCGCTGCTGTCG
GTGTTCCCGGCCGCCTTGCTCGGCCGCCTGCTGGTGGTGCCGTATTACCCGCTGACCGACGCCACGCTGG
GCAACATCGTGCGCCTGCAGCTGGGGCGCATCCAGCGTCGCCTGGCGGAGAATCACGACATCGTCTGCAC
CTTCGACGACGCGGTCATCGAGCAGATCGTCAGCCGCTGCTCCGAGGTGGAGTCCGGTGGCCGCATGGTC
GACGCCATCCTGACCAACACCCTGCTGCCGCAGATCAGCCACACCCTGCTGACCGGCAGCGCCAACGACC
AGCGCTATCGCCAGCTGCATATCGCGCTGCAGAACCACGAATTCATTTGTCAATTTCAGGCATAA