SecReT6
Protein ID: 563652572
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05110
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1091823..1092302 [-]
ProductHcp
NoteTssD
UniProt IDV5RZG4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-26, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|563652572|ref|YP_008860633.1| Hcp [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MANLSYLTLNGEKQGLISAGCSSMASIGNKAQIAHIDQILVLALEHGVTRNQNVNHLALTIRKPVDKATP
LLNKAITENEILTCDIEFYRTNRFGINEMYYKIQLLKARIASIHLIVPHTVSSSDGQPEENISFIYETFT
HEHCIAGTSAFSTWNTRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1092302-1091823 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGCGAATTTAAGTTATTTGACACTTAATGGAGAAAAACAGGGACTGATTTCAGCGGGGTGTTCATCAA
TGGCATCCATTGGCAATAAGGCACAAATCGCTCACATCGATCAAATTTTAGTCCTGGCCCTTGAACATGG
CGTCACGCGGAATCAAAACGTAAACCACCTTGCTCTGACTATTCGAAAACCAGTGGATAAAGCTACTCCT
TTGTTAAATAAAGCAATTACAGAAAATGAAATTCTGACCTGCGATATTGAGTTTTACCGGACTAATCGCT
TCGGTATAAATGAGATGTATTACAAAATACAGTTGCTTAAAGCCCGTATTGCAAGCATTCATTTAATAGT
TCCACATACGGTAAGCAGCAGTGACGGGCAACCGGAAGAAAATATATCATTTATTTATGAAACATTTACG
CATGAACATTGTATTGCGGGGACCAGTGCATTCAGCACCTGGAATACGCGTCTTTTTTAA