SecReT6
Protein ID: 563652573
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05115
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1092321..1093682 [-]
Producttype VI secretion protein ImpA
NoteTssA
UniProt IDV5S1L6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 8.80E-46, Aligned region: 93..156
DUF3702 [PF12486], Evalue: 8.80E-46, Aligned region: 262..271
DUF3702 [PF12486], Evalue: 8.80E-46, Aligned region: 292..438
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 240..265
Protein Sequence: 453 a.a.     [Download]
>gi|563652573|ref|YP_008860634.1| type VI secretion protein ImpA [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDLHTATYYTLAR
TRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNILRQQLSFSGADLPLLYRTERA
LQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDIPPQTTVRTLIYAPESTQPVTEENLPPL
PELPEMKVEVHHGAVEDPEPVARATSGRTIKGFMAGVVCAAAVAAVLWWWQVYPMQQQLAQVRDTAQGAA
TLWLASPELDSYGQRLQQLPDASPLQLLEAGMQMMRTADSRWPESLQQQQATAQWNEILKTRAQSSPQMR
GWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRNTEALEK
QINERLDGVLSRWLLLKNNILTTTATETEAGKR
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1093682-1092321 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGAGTCAGGACGCACTCACGCACATTATTGTTACCGGCCAGGATCCGCGCGGCCTGCCGGAGTTCAGCG
CCCTGCGGGAAGAGATCAACAAATCGTCTCACCCGTCGCAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACTTATTACACCCTGGCGCGC
ACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGGGTGGAGCTGCTGGCGGCCATGATAAGCCACGACT
GGGACAAATTCTGGCCACAGGATGAGTCAGCCCGCACCGGGATGCTCGACTGGCTTAATTCGCGCACCGG
CAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTGCTGTACCGCACCGAACGGGCG
TTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGCATGTGGAGAACCTGCTTT
ATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGTGGACATTCCGCCGCAGAC
CACCGTCAGAACGTTGATCTACGCCCCGGAGAGCACGCAGCCCGTCACGGAGGAAAACCTTCCGCCCCTG
CCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATCCAGAGCCTGTCGCCAGGG
CCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGCGGCTGTCGCTGCCGTCCT
CTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTCAGGGACACGGCGCAGGGCGCGGCA
ACGCTCTGGCTGGCCTCGCCTGAACTGGACAGCTACGGGCAGCGGTTACAACAGCTTCCCGACGCCTCGC
CGCTGCAACTGCTGGAGGCGGGGATGCAGATGATGCGAACCGCAGACAGCCGCTGGCCGGAAAGTCTGCA
ACAGCAGCAGGCGACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAAAGCAGCCCGCAAATGCGC
GGCTGGCAGCAGGCGCGCCAGAATCTGCGTGACTTTGCTGACCTGATGATGCAGCGGGAAACGGAGAAGC
AGGGCTTTACCCTCTCCTATATTAAAACGGTGACCTGGCAGGCGGAACGCCTGCTGAATCAGGAAACGCC
GCTGGAATCCCTGCTGACGCAGTACCAGGATGCCCGCGCTCAGGGACGGAATACGGAGGCGCTGGAAAAA
CAAATTAATGAACGGCTGGATGGGGTGTTAAGCCGCTGGCTGTTGCTGAAAAACAATATACTGACGACGA
CGGCAACCGAAACGGAAGCCGGAAAGAGATAG

Protein ID: 563652575
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05125
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1097233..1098645 [-]
ProductCAD protein
NoteTssA
UniProt IDV5RZ67
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.60E-09, Aligned region: 52..109
ImpA-rel_N [PF06812], Evalue: 4.60E-09, Aligned region: 395..407
Protein Sequence: 470 a.a.     [Download]
>gi|563652575|ref|YP_008860636.1| CAD protein [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MDLRDPNTWISHLLENLPDDKLACALKDDNPGWEYIDGEMLKLGSLAHSQLDIPEIQRRGLVILASESKD
FRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQNAAHKQRFATQVLKRFETGVESFAETARTAQR
DSLLAELAKLAQRWQEQNIPALTQAVDDLSSQYRRAFRGAAPVPPAAGPSTHPAPVSATPSAPVSPSAPA
ATTAPAVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQAITSVPQAESDGRTPLAAVPAD
MTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQAAQRLGYTSAAEAIRDEVVRFLARLPQLATL
LFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVRQCFSEQGLEAALRYLETLPEGDPRDRFHRQY
LGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLLEQLENKLTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1098645-1097233 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGACTTACGCGACCCGAATACCTGGATTTCGCACCTGCTGGAAAATCTGCCGGATGACAAACTGGCCT
GCGCGCTGAAAGACGATAATCCCGGCTGGGAATATATCGACGGCGAAATGCTTAAACTCGGCTCGCTGGC
GCACAGCCAGCTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGATCCTGGCCTCGGAAAGCAAGGAT
TTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGTGATCCGCTGCTGGCGCTGCGTCTGC
TGGCGCTGTACGTGGAGCATTACTGGACTGTGGCGGCACCGCAAAATGCGGCACATAAACAGCGTTTCGC
CACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAGAGACAGCCCGTACCGCGCAGCGC
GACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGAGCAGAATATCCCGGCGCTGACAC
AGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGGGCCGCCCCGGTGCCGCCAGCGGC
TGGCCCGTCCACGCATCCGGCTCCGGTTTCGGCCACGCCGTCCGCCCCGGTATCACCGTCTGCGCCTGCG
GCGACGACGGCGCCAGCGGTGGATATCGACAGCCATGACGACAAAGCCTGGCGCGACACGCTGCTGAAAG
TGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTACCGCCTGCGCCGCCATGCGTTATG
GCAGGCCATTACATCCGTCCCCCAAGCCGAAAGCGACGGGCGCACACCGCTGGCGGCGGTGCCTGCCGAC
ATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCTCTGGCAACAGGTGGAAAAAAGCC
TGCTGCTGGCCCCGTACTGGCTCGATGGTCATTACCTTTCAGCGCAGGCCGCACAACGCCTGGGCTACAC
CAGCGCGGCAGAAGCCATCCGGGATGAGGTGGTCCGTTTTCTCGCCCGCCTGCCGCAACTTGCCACCCTG
CTGTTTAATGACCGCACGCCGTTTATCAGCGAACAGACAAAACAGTGGCTGGCGGCGTCTCCGGGTAGTC
AGACAGCCCCGATGGTGCGGACCAGTGAAGACACCGAGGCTGTCCGCCAGTGTTTCAGCGAGCAGGGGCT
GGAGGCCGCGCTGCGATACCTGGAAACCCTGCCGGAAGGCGATCCGCGCGATCGGTTCCACCGGCAGTAT
CTTGGCGCGCAACTGTTAGAAGAAGCCGGGATGGCGCAACTGGCACAGCAACAGTACCGGATGTTGTTTA
AAGCAGGGCTGCGCATGACGCTGGCTGAATGGGAGCCGTCCCTGCTGGAACAACTGGAAAACAAACTCAC
GGCAGAACAGTAA