SecReT6
Protein ID: 563652577
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05135
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1099381..1102116 [-]
Productprotein disaggregation chaperone
NoteTssH
UniProt IDV5RZH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-38, Aligned region: 265..265
AAA_2 [PF07724], Evalue: 3.20E-38, Aligned region: 630..791
AAA [PF00004], Evalue: 5.20E-18, Aligned region: 30..57
AAA [PF00004], Evalue: 5.20E-18, Aligned region: 223..334
AAA [PF00004], Evalue: 5.20E-18, Aligned region: 636..754
AAA [PF00004], Evalue: 5.20E-18, Aligned region: 767..827
AAA_5 [PF07728], Evalue: 4.60E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 4.60E-14, Aligned region: 635..756
ClpB_D2-small [PF10431], Evalue: 1.10E-12, Aligned region: 797..873
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 24..70
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 486..544
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 610..676
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 701..729
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 25..68
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 634..669
AAA_14 [PF13173], Evalue: 2.60E-05, Aligned region: 222..322
AAA_14 [PF13173], Evalue: 2.60E-05, Aligned region: 635..725
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 282..307
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 630..664
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 768..827
NACHT [PF05729], Evalue: 4.50E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 4.50E-05, Aligned region: 636..664
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 633..660
AAA_19 [PF13245], Evalue: 0.00022, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00022, Aligned region: 627..657
DUF258 [PF03193], Evalue: 0.00028, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.00028, Aligned region: 636..654
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 117..123
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 290..302
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 552..616
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 629..650
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 703..729
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 768..851
AAA_18 [PF13238], Evalue: 0.0043, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0043, Aligned region: 636..671
Arch_ATPase [PF01637], Evalue: 0.0054, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 0.0054, Aligned region: 275..309
Arch_ATPase [PF01637], Evalue: 0.0054, Aligned region: 636..656
Arch_ATPase [PF01637], Evalue: 0.0054, Aligned region: 706..717
AAA_17 [PF13207], Evalue: 0.007, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.007, Aligned region: 636..670
Zeta_toxin [PF06414], Evalue: 0.0077, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0077, Aligned region: 634..675
Protein Sequence: 911 a.a.     [Download]
>gi|563652577|ref|YP_008860638.1| protein disaggregation chaperone [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MIQIDLATLVKRLAPFAKQALEAAASECMSQQAAEITVAHVLLQMLATPRSDFRVIAERAEIGADDLRQA
LTVENYAAARSSDSYPSFSPMLVEWLKEAWLLASAEMQQTELRGGVLLLALLHSPLRYLPPAAARLLTAI
NRDLLRQDFAGWTKESAESVILNADGQAASAIADTGDTLLARYAKNMTDDARQGRLDPVLCRDNEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIIAGQVPDKLRDTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVIQSPKPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDEALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLRHQCEAEIRQLEREIRIGLRSDTSRLTEVIVQYDETLTELDALEAAWRQQQTL
VQEIIALRKGLLDETDATGNDETATPETEAVGSDDESVTAPPEAEPEISPAARLAQLTAELDALHHTQLL
VSPHVDKKQIASVIAEWTGVPLNRLSQNEMSVITDLPQWLGDTIKGQALAIKHLHKHLLTARADLRRPGR
PLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAI
RQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNVVFFLTSNLGYQVIVEHADNPEAMQ
EALYPVLADFFKPALLARMEVVPYLPLSKETLAVIIAGKLARLDNVLRARFGAEVVIEPDVTDEIMQRVT
RAENGARMLESVIDGEMLPPLSLLLLQKMAANIAIARITLGVANGAFTADVEDVPDEDTQPVAETEDEAV
L
 
Nucleotide Sequence: 2736 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1102116-1099381 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGATCCAGATTGACTTAGCCACCCTGGTAAAACGGCTTGCTCCCTTCGCGAAACAGGCGCTGGAAGCGG
CGGCGTCGGAGTGTATGAGCCAGCAGGCGGCAGAAATTACCGTCGCGCATGTGCTGCTACAGATGCTGGC
GACCCCGCGCAGCGACTTTCGGGTGATTGCCGAACGTGCGGAGATCGGCGCCGATGATTTACGCCAGGCG
CTGACGGTGGAAAATTACGCTGCCGCCCGTTCATCTGACAGCTACCCGTCGTTTTCCCCGATGCTGGTTG
AATGGCTGAAAGAGGCCTGGCTGCTGGCCTCCGCGGAAATGCAGCAGACCGAACTGCGCGGCGGCGTGCT
GCTGCTCGCCCTGCTGCATTCGCCGTTGCGCTACCTGCCGCCCGCCGCCGCCCGGCTGCTCACCGCCATC
AACCGCGACCTGCTCCGGCAGGATTTTGCCGGGTGGACGAAGGAGTCCGCCGAATCGGTGATCCTGAATG
CGGACGGGCAGGCCGCCAGCGCCATAGCCGATACCGGCGACACCCTGCTGGCCCGCTATGCCAAAAACAT
GACCGACGATGCCCGCCAGGGACGGCTTGATCCGGTGCTGTGCCGCGATAACGAAATTGACCTGATGATC
GATATCCTCTGCCGCCGCCGTAAAAATAACCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATTATTGCCGGTCAGGTGCCGGACAAGCTGCGCGATACCGATATTAT
GACGCTGGATCTCGGCGCCTTGCAGGCGGGCGCGTCGGTAAAAGGCGAGTTTGAGAAGCGCTTTAAGGGG
CTGATGGCGGAAGTCATTCAGTCGCCGAAACCCGTCATCCTGTTTATCGACGAAGCCCACACGCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTGAAACCAGCGCTGGCGCGCGGCGAACT
GAAAACCATCGCCGCCACCACCTGGAGCGAATACAAAAAATACTTCGAGAAAGACGCCGCCCTGTCGCGC
CGTTTCCAGTTAGTGAAAGTCAGCGAACCCAATGCTGCCGAAGCCACCATTATCCTGCGCGGCCTGTCGG
CGGTGTATGAGCAGTCCCACGGCGTGCTGATTGACGATGAAGCGTTACAGGCCGCCGCGACGTTAAGCGA
GCGCTACCTGTCAGGCCGCCAGTTGCCGGATAAGGCCATTGATGTGCTGGATACCGCCTGCGCCCGCGTG
GCGATTAACCTTTCGTCGCCGCCGAAGCAAATTTCGGCGCTGACGACTCTGCGCCACCAGTGTGAAGCTG
AAATACGCCAGCTTGAGCGCGAAATTCGCATCGGCCTGCGGTCGGATACTTCACGGCTGACTGAAGTTAT
CGTTCAGTATGACGAAACGCTGACCGAACTGGATGCGCTGGAGGCCGCGTGGCGCCAGCAGCAGACGCTG
GTGCAGGAAATTATCGCGCTGCGTAAGGGGCTGCTGGACGAAACGGACGCTACCGGCAACGATGAAACCG
CAACGCCTGAAACAGAGGCTGTGGGCAGTGACGATGAATCCGTCACAGCGCCGCCGGAAGCGGAACCTGA
AATTTCGCCCGCCGCCCGCCTCGCGCAGCTCACCGCCGAACTGGACGCCCTGCACCACACGCAACTGCTG
GTCTCCCCGCACGTCGATAAAAAACAGATAGCCAGCGTGATTGCCGAATGGACCGGCGTGCCGCTTAACC
GCCTGTCACAAAACGAAATGTCGGTCATCACCGACCTGCCGCAGTGGCTGGGCGACACCATCAAAGGCCA
AGCGCTGGCGATTAAGCACCTGCATAAACACCTGCTGACCGCCCGCGCCGATCTGCGCCGTCCGGGACGT
CCGCTCGGCGCGTTCCTGCTGGCCGGTCCCAGCGGTGTCGGCAAAACCGAAACCGTGCTGCAACTGGCCG
AACTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAACATGTCGGAGTTTCAGGAAAAACACACCGT
TTCACGCCTGATTGGTTCCCCGCCGGGCTATGTCGGCTACGGCGAAGGCGGCGTGCTGACCGAAGCGATT
CGCCAGAAACCGTACTCCGTGGTGCTGCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTCAACCTGT
TCTACCAGGCGTTCGACAAGGGCGAGATGGCCGACGGCGAAGGCCGTCTTATCGACTGCAAAAATGTGGT
GTTCTTCCTCACCTCCAACCTCGGTTATCAGGTGATTGTCGAACATGCCGACAACCCGGAAGCCATGCAG
GAAGCACTGTACCCGGTACTGGCGGATTTCTTTAAACCGGCGCTGCTGGCGCGTATGGAAGTGGTGCCGT
ACCTGCCGTTATCTAAAGAAACGCTTGCCGTCATTATCGCCGGGAAGCTGGCGCGGCTGGACAACGTGCT
GCGCGCCCGCTTCGGCGCGGAGGTGGTGATTGAGCCGGACGTGACTGACGAAATCATGCAGCGCGTCACC
CGCGCCGAAAACGGCGCGCGGATGCTGGAGTCGGTCATCGACGGCGAGATGCTGCCGCCGCTCTCCCTGC
TGCTGTTGCAGAAAATGGCGGCGAATATCGCCATCGCCCGTATCACGCTGGGCGTGGCAAACGGCGCGTT
TACCGCGGATGTGGAGGATGTGCCGGATGAGGATACTCAGCCCGTAGCGGAAACAGAGGACGAAGCCGTT
CTATGA