SecReT6
Protein ID: 563652578
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05140
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1102129..1102887 [-]
Productmembrane protein
NoteTssL
UniProt IDV5S1M3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.40E-63, Aligned region: 30..234
Protein Sequence: 252 a.a.     [Download]
>gi|563652578|ref|YP_008860639.1| membrane protein [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MDELSLPPLPGYEREGQRQYQLALRGNSLNPMIDAATPLLGMVMRVSGMNSHAMPEHLFTQVVTDVQAVE
QLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLMREPK
RYQDLLEFLYICFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLIKR
LTIRHVLCGGIVVLALFYLFYLLRLDSQTQDILHQLNRLLAR
 
Nucleotide Sequence: 759 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1102887-1102129 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGATGAGCTGTCACTGCCCCCTTTACCCGGATACGAGAGAGAAGGCCAGCGCCAGTATCAGCTGGCGC
TGCGCGGCAACAGCCTGAACCCGATGATCGATGCCGCCACCCCGCTGCTGGGGATGGTGATGCGCGTTTC
GGGCATGAACAGTCATGCCATGCCTGAACACCTGTTCACCCAGGTGGTGACGGATGTGCAGGCGGTGGAG
CAGTTACTCCAGGAGCAGGGTTATGAGCCTGGGGTGATTATCTCGTTTCGTTACATCCTGTGTACCTTTA
TTGACGAGGCGGCGCTGGGGAATGGCTGGTCGAACAAAAACGAGTGGATCAAGCAGTCGCTGCTGGTGCA
TTTCCATAACGAAGCCTGGGGCGGTGAAAAGGTTTTTATCCTGCTGGAGCGCCTGATGCGCGAACCCAAA
CGCTACCAGGATCTGCTGGAATTTTTGTACATCTGCTTTTCGCTGGGCTTTCGCGGGCGTTACAAAGTCG
CCGTCCAGGACCAGGGGGAGTTTGAGCAGATATACCGCCGCCTGTATCACGTCCTGCATAAGCTGCGCGG
CGACGCACCCTTTCCGCTGCTGCACCAGGATAAAAAAACCCAGGGCGGGCGCTATCAGCTGATTAAGCGG
CTGACCATCCGGCATGTTCTGTGCGGCGGCATCGTCGTGCTGGCGCTGTTTTATCTGTTTTATCTGCTGC
GTCTGGACAGTCAGACGCAGGACATTCTTCATCAGTTAAACCGGCTGCTTGCCAGGTAA