SecReT6
Protein ID: 563652579
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05145
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1102892..1104223 [-]
Producthypothetical protein
NoteTssK
UniProt IDV5S0M8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-147, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|563652579|ref|YP_008860640.1| hypothetical protein Q786_05145 [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MATTRNKVMWREGTLMRPHHLQQQQRYNDYVNNLRFRAIHDLSWGFTELSLNDELLGQGKIMIDSASGTL
PDGTVFSLPDQDALPDPLHPDSFPDEESRNVYLALPVASDVRGEVSYGQQVGRYRLNDASVRDLHSENGD
ARTLTLGQLTPRIMSGADDMSAYVTLPLCRIKDRRADGSLMLDENFIPTCQNVYVSARLREFLREVQEAV
GGRANDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRPHLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHRNLTDTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSTLLQSATFVLAVAA
KMETLQLQRQFIQQSKISSPEKIRNMVSVQIPGIPLHTLMVAPRQLPYHAGFSYFELDKSGAAWADVAAT
GAVALHVSGTFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1104223-1102892 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGCAACCACGCGAAACAAGGTGATGTGGCGGGAAGGAACGCTGATGCGTCCGCACCATCTCCAGCAGC
AACAACGTTATAACGATTATGTGAATAATCTGCGTTTCCGGGCCATTCATGATTTGTCCTGGGGATTTAC
CGAGCTTTCCCTCAATGATGAGCTGCTGGGACAGGGCAAAATTATGATCGACAGCGCGTCGGGCACCCTG
CCGGACGGCACCGTGTTTTCCCTTCCGGACCAGGATGCGCTCCCCGATCCGCTGCATCCGGACAGTTTTC
CTGATGAGGAAAGCCGCAATGTCTATCTGGCCTTACCCGTTGCCAGCGATGTGAGAGGCGAAGTCAGTTA
CGGGCAGCAGGTTGGGCGTTACCGGCTGAACGATGCCAGTGTCCGGGATCTGCATTCCGAGAATGGCGAT
GCCCGGACGCTGACGCTGGGCCAGTTGACCCCCCGCATTATGAGCGGAGCGGACGATATGAGCGCGTATG
TCACGTTGCCGCTGTGCCGTATCAAAGACAGGCGTGCGGACGGCTCCCTGATGCTGGATGAAAACTTTAT
CCCCACCTGCCAGAACGTCTATGTCAGCGCACGGCTGCGTGAATTTCTCCGGGAAGTCCAGGAAGCGGTT
GGCGGCCGGGCCAATGACCTGGCTAACCGCATTGGCTCTCCGGCGCAAAGCGGTATTGCCGACGTTGCGG
AATTTATGATGCTGCAACTGCTCAACCGTAACCAGACGCGGTTCACCCACCGCGCCCGCAGGCCGCACCT
CCATCCGGAAGATTTTTATCTCGATCTGGCCGGGCTGCTGGGCGAGCTGATGACATTTACCGAGCCATCC
CGCCTGCCCTGTCCGCTGGATGTCTACGATCACCGTAACCTGACGGACACCTTCAAAACGCTGTTGCCGG
AAGTGAAACGGGCATTACATACCGTCCTGTCGCCCAGGGCGGTTAACCTGCCGCTGCATCTGCGCGATGG
CATCTGGCAGGCTGACGTACATGACTCCACGCTGTTGCAGTCGGCCACCTTCGTGCTGGCGGTGGCGGCG
AAAATGGAGACGCTGCAACTCCAGCGCCAGTTTATCCAGCAGTCAAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGCGTGCAAATCCCCGGCATCCCGCTGCATACGCTGATGGTGGCCCCCCGCCAGCTTCC
GTACCATGCCGGTTTCAGCTATTTCGAACTGGACAAGAGCGGGGCCGCCTGGGCGGATGTGGCGGCCACC
GGCGCTGTCGCCCTGCATGTTTCCGGTACGTTCCCGGATCTGAACATGCAACTGTGGGCCATAAGAGGAT
AA