SecReT6
Protein ID: 563652580
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05150
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1104226..1104759 [-]
Producthypothetical protein
NoteTssJ
UniProt IDV5RZ72
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.80E-33, Aligned region: 17..170
Protein Sequence: 177 a.a.     [Download]
>gi|563652580|ref|YP_008860641.1| hypothetical protein Q786_05150 [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MTGRGFLAWAMVALFTLALCGCETVKKIGEVIKNPDIQVGKLADQSSQVTITLLTEPDANINADGEAAAV
DVQLVYLSDDSKFQAADYDQIATTALPDALGKNYIDHQDFSLLPDTMKTLPQVKLDEKTQFIGVIAYFSD
DQTTEWKQIEPVEGTGHNYRLLVHIRQSSIEMKKEDD
 
Nucleotide Sequence: 534 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1104759-1104226 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGACAGGCCGTGGTTTCCTCGCCTGGGCGATGGTGGCGTTGTTCACCCTCGCCTTATGCGGTTGTGAAA
CGGTAAAAAAAATCGGCGAGGTGATCAAAAACCCGGATATTCAGGTCGGTAAGCTGGCAGACCAGTCTTC
GCAGGTGACGATTACGCTGCTGACGGAGCCGGATGCCAATATCAACGCGGACGGTGAAGCGGCTGCGGTG
GACGTGCAGCTGGTTTATCTGAGCGATGACTCAAAATTTCAGGCGGCCGACTACGACCAGATAGCCACCA
CCGCACTGCCCGACGCGCTGGGGAAAAACTATATCGATCACCAGGATTTCAGCCTGCTGCCCGACACCAT
GAAAACCCTGCCGCAGGTGAAGCTGGATGAGAAAACGCAGTTTATCGGCGTGATTGCCTATTTTTCCGAC
GACCAGACCACGGAATGGAAGCAAATCGAACCGGTAGAAGGGACAGGACACAACTACCGCCTGCTGGTGC
ATATCCGGCAGAGCAGTATTGAAATGAAAAAAGAGGATGATTAA