SecReT6
Protein ID: 563652581
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05155
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1104756..1106042 [-]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDV5RZV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 428 a.a.     [Download]
>gi|563652581|ref|YP_008860642.1| type VI secretion system protein ImpI [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MAEEKARQQTLSLHVVNGNELESGRTARCLFTGDGDVGHGSECHWPVQDRHQNVPAKAFSISLHDGAFCL
HPLASPLWLNQAKVTAASDQVQLRQGDEIQTGHLILRVYLNQGGMRHYDEEMATPETIVSNHDLLSDTLL
STDGAPEYPGMPSRHQLADTVVNGFSTDPLQVLQAESLTTRDNPLAGITPARPSAPLSDPAINGGINTPF
MDLPSMYADPHDNEEGMSPADAAQRHLAVTPLLRGLGGSLAVHNTQDADDFLEEAGRTLQAAIQGLLELQ
QRRNSLSDKHLRPLEDNPLRLNMDYATALDVLFAEGKSPVHLAAPAAVSESLRNIRHHEEANRAAIVESL
RVLLDAFSPQSLMRRFVQYRRSHELRKPLDDAGAWQMYCDYYDELASSRQQGFEMLFNEVYAQVYDRVLR
EKQREPEA
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1106042-1104756 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGCGGAAGAAAAAGCGCGGCAACAGACGCTTTCACTGCATGTCGTTAACGGTAACGAGCTGGAGAGCG
GACGTACCGCACGGTGTCTGTTCACCGGAGACGGCGATGTGGGCCACGGCAGCGAATGCCACTGGCCTGT
TCAGGACCGGCACCAGAACGTTCCGGCGAAGGCGTTCAGCATCAGCCTGCATGATGGCGCATTCTGCCTG
CATCCGCTGGCTTCGCCATTATGGCTGAACCAGGCTAAAGTCACGGCGGCCTCAGACCAGGTGCAGTTAC
GCCAGGGCGATGAGATCCAGACCGGGCATCTGATACTCCGGGTTTATCTGAACCAAGGCGGGATGCGGCA
TTACGATGAGGAGATGGCGACGCCTGAAACTATCGTTTCTAACCACGACCTCCTGTCGGACACGCTGCTG
TCCACGGACGGCGCGCCGGAATATCCGGGAATGCCGTCCCGCCATCAGCTCGCGGATACCGTTGTTAATG
GCTTTTCCACCGATCCGTTGCAGGTGCTCCAGGCTGAAAGTCTGACCACCAGGGACAATCCGCTTGCGGG
TATCACCCCGGCCCGGCCCTCCGCCCCGTTATCCGATCCGGCGATAAACGGCGGGATCAACACGCCGTTT
ATGGATCTGCCGTCCATGTATGCCGATCCACATGATAATGAAGAGGGCATGTCACCAGCAGACGCGGCGC
AGCGCCATCTCGCCGTCACGCCGTTACTGCGCGGGCTGGGGGGATCGCTTGCCGTGCATAACACCCAGGA
CGCCGACGATTTTCTGGAAGAGGCCGGAAGGACATTGCAGGCGGCGATTCAGGGGTTGCTTGAGCTACAG
CAGCGCCGCAACAGCCTGTCAGACAAGCATCTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAATATGG
ACTACGCCACGGCGCTGGACGTGCTGTTTGCCGAAGGGAAAAGCCCGGTACATCTGGCCGCGCCCGCCGC
CGTCAGCGAGAGCCTGCGCAATATTCGTCATCACGAAGAAGCCAACCGCGCCGCGATTGTGGAATCGCTG
CGCGTGCTGCTGGACGCCTTCTCGCCACAGAGTCTGATGCGCCGTTTTGTGCAGTACCGCCGCAGCCACG
AACTGCGTAAACCGCTGGATGATGCCGGTGCGTGGCAGATGTACTGCGATTATTACGATGAGCTGGCCTC
CAGCCGCCAGCAGGGTTTTGAGATGCTGTTTAACGAAGTGTATGCCCAGGTGTATGACCGGGTGTTGCGT
GAAAAGCAGCGGGAGCCGGAAGCATGA