SecReT6
Protein ID: 563652582
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05160
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1106067..1107155 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDV5RZH6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-88, Aligned region: 34..349
Protein Sequence: 362 a.a.     [Download]
>gi|563652582|ref|YP_008860643.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MGGKNRATPAHLSPDETPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPVLSLDTPPAQETI
RFHADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHLAWKSAHEQSPVSDFLDMFSH
RLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHRQLRDSLPVNHSKMLAYAGILANPGRSPEIV
CTLVAHCFDLNLSDVTLQNWQRRMVDIEPDQQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKFQL
SINHLSRKQFLSFLPSGENFLPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLGEP
GEHPSVTIRVRE
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1107155-1106067 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGGCGGAAAGAACCGGGCAACACCCGCTCATCTGAGTCCGGACGAGACTCCGGCGCAGGATGAACAAC
GCACGCTGCGGGAGCCGTTGTTTCAGGATGCCTGCGCCTGTAATTTTTTCGCGCTCTCTGAGCTGCTGCA
CCGGCTGGCATCAGAAGGCGGCGAAACGCCAGTGTTATCCCTGGATACCCCTCCGGCGCAGGAAACCATT
CGTTTCCATGCGGACGCCAGCCTGGGATTTCCGGTAAGCGATGTCAGCGCGCTGGAGCAGGATGCTTCCG
GATTGTTCCGGATGACCACCACCTTTATGGGATTGCAGGGCAGCCAGTCGCCCCTCCCCGGCTATTACCT
TGATCACCTGGCCTGGAAATCCGCGCACGAGCAGAGTCCGGTCAGCGATTTTCTGGATATGTTCAGCCAT
CGCCTGACGCAGTTTGTCTGGCATATCTGGCGTAAGTACCGTTACCACGTAGCGTTCCGTAACGGCGGCG
TGGATGCGTTCTCGCAGCGGATGTATTCCCTGGTGGGGCTGGGCCACCGGCAGCTTCGCGACAGCCTGCC
CGTTAACCACAGTAAGATGCTGGCCTATGCCGGGATACTGGCAAATCCGGGACGTTCGCCGGAGATCGTC
TGCACACTGGTTGCGCACTGTTTCGATTTAAATTTATCGGACGTGACGCTGCAAAACTGGCAGCGGCGGA
TGGTGGATATCGAGCCGGATCAGCAGAACAGTCTTGGATGTTACACGATTAAAAATGGCGAAAAACTGGC
TGGGCGATCGGTGCTGGGCAATTTTGTCCTCGGTACGCGGGTTCCCGATCTCAGCGGTAAATTTCAGTTA
AGTATTAACCACCTGAGCCGCAAGCAGTTTCTCTCGTTCCTGCCGTCAGGAGAAAATTTTCTGCCGCTGG
CGATGTTTGTCTCCTTCGTCCTGCGCGATCAGCTTGCCTGGGATTTACACCTGGGGCTGGCCCCGGATCA
GGTGGGGATTATGCGGCTGGGCGATAACAAGAGCGCGCTGCTGGGCTGGACGTCATTTCTCGGCGAGCCG
GGAGAGCATCCCTCAGTCACCATCAGGGTCAGGGAGTAA