SecReT6
Protein ID: 563652583
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05165
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1107119..1108972 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDV5S1M8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-192, Aligned region: 5..617
Protein Sequence: 617 a.a.     [Download]
>gi|563652583|ref|YP_008860644.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIRMLWPNYLRPVPSMTLIEYAPDMDKTSVPVLIPRNEQFTTGAKGTQGNAVLSAYSGNEHDVAPPCTFT
LCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFATLDLNRLRFWLGNDDNYTRYQLYLWFCEYLQ
GAELMAGGQSIPMPEFMLKAVGFESEDAMLPWPGNVHSGYRVLQEFFCYADSFLFFDACGIPALPDRLKE
NRFTLRLRFSRPLPADIRLRDDSLRLYCAPAINLFAHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNS
VVSQTQGKHRKADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTLAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPVIDGSLHWSLL
SAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETTPVDRLFTGIPVRGLASTLSI
HPEPFVCEGEMYLLGAVLSHFLSLYASVNSFHMLTVVNTESQESWKWAERTGQHPLI
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1108972-1107119 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGAATTCGAAGAACGCTATTACAGGCAGGAGTTGGATCACCTGCGGCAGTTGAGCAAGCTGCTGGCGA
CCGAAAAGCCGCATCTGGCCCGGTTTCTGGCAGAAAAAGAGGCCGATCCGGATATCGAGCGTTTGCTGGA
GGGCGTGGCCTTTCTGACCGGCAATCTGCGCCAGAAAATCGAGGATGAGTTTCCGGAGCTGACGCACGGA
CTGATCCGGATGCTGTGGCCCAATTATCTGCGCCCGGTGCCGTCGATGACGCTGATTGAATATGCGCCGG
ATATGGATAAAACCTCCGTGCCGGTACTGATCCCCCGTAATGAGCAGTTCACAACCGGGGCGAAGGGGAC
TCAGGGAAACGCGGTATTGTCTGCGTATTCCGGCAATGAGCACGATGTAGCCCCGCCCTGTACGTTCACT
CTTTGCCGGGATATCTGGCTGTTACCCGTTCAACTGGATCAGGTTGAAAATCGCAGTACGCCCCGCCACG
GCATTATTGATATTACGTTTGCCGTCGCACCGGGCACTGATTTTGCCACGCTGGATCTGAACAGGCTGCG
CTTCTGGCTGGGCAACGATGATAACTATACCCGCTACCAGCTTTATCTGTGGTTTTGTGAATATTTACAG
GGCGCAGAGTTGATGGCGGGCGGGCAGTCGATCCCGATGCCTGAATTTATGCTGAAAGCGGTGGGTTTTG
AGTCAGAGGACGCCATGCTGCCCTGGCCCGGTAATGTCCACAGCGGCTACCGTGTTCTCCAGGAGTTTTT
CTGCTACGCCGACAGTTTTCTGTTTTTCGATGCCTGTGGCATTCCGGCATTGCCAGACCGGTTGAAGGAG
AACCGTTTCACTCTGCGGCTACGGTTTTCACGCCCCTTACCGGCAGATATCCGGCTGCGGGATGATTCCC
TGCGCTTATATTGTGCGCCCGCCATTAATCTGTTTGCCCACCATGCCGAAGCCATCACGCTGGATCATCA
GCGGCAGGATTACGCTCTGGTTCCCAGCCGTCATTTTCCGGATCATTACGATATTTTTTCGGTTAACAGC
GTGGTGAGTCAGACACAGGGGAAGCACAGAAAAGCGGATCTTGGACGGCCAGTGATCACAGAGGCCGCGC
GCCACTGGCCTGCTTTTGAGAGTTTCCGCCACCAGATGGAGTACAGCCGTAAGCGGGAAGTGGTCTACTG
GCAGCACCGGACCAGGACCTCGCTGTTTCACCGGGGCTTTGATCATACCCTGGCTTTTATTCATGCCGAT
GGCAGCCTCCCGGATGCCTCACTGCTTAATAATGAAGTGGTTTCGGTATCGCTGACCTGCACCAACCGGG
AGTTGCCGGTACAGCTACGGCCCGGCGATATCACCGGTACGACAGGTAAAAACGCGTCAGTGGCGTCATT
TCGCAATATCACCCGCCCCACCAGACCGCTCTGGCCGGTGATTGACGGCAGCCTGCACTGGTCGTTGCTG
TCTGCCATGAACCTGAATTATCTGTCGTTGCTGGATGCTGATGCGCTCAAACAGGTTATCGCCAATTTTG
ATCGCCACGCCATTCATCATCCGCAGATGGCCCGTCTGTCACAACAGAAGCTGGACGCCATTGAACGGCT
GGAAACTACGCCTGTTGATCGCCTGTTTACCGGCATACCGGTGCGCGGGCTGGCGTCCACCCTGTCCATT
CATCCGGAGCCGTTTGTCTGCGAGGGTGAAATGTATCTGCTGGGCGCGGTGCTGTCGCATTTTCTGTCGC
TGTACGCCAGCGTCAATTCGTTCCACATGCTGACCGTCGTTAATACGGAAAGCCAGGAGTCATGGAAATG
GGCGGAAAGAACCGGGCAACACCCGCTCATCTGA