SecReT6
Protein ID: 563652584
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05170
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1108977..1109393 [-]
Producttype VI secretion protein
NoteTssE
UniProt IDV5S0N4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-15, Aligned region: 32..115
Protein Sequence: 138 a.a.     [Download]
>gi|563652584|ref|YP_008860645.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MIPARERPAGSLFERLENPPVRNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGIEEPEGSDNYR
SAMSQAIVQCIERYEPRISHAEVRAILPQAASPQEIIFRITAWVTFNDIDDVLEFDMAPDGSQHYRVE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1109393-1108977 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
GTGATACCGGCGCGCGAAAGGCCTGCCGGATCGCTGTTTGAGCGTCTGGAAAACCCTCCCGTCAGAAACT
GGCGGGAGGGCAGTAATATAGAGGCGTTCAGGCAGTCCATTCGCCATAGTCTGCGCAATATCCTGAACAC
CCGTTCCGGCAGTTGTCGGGGAACGCCGGGGCTGGGTATTGAAGAGCCGGAAGGGTCGGATAATTACCGC
AGCGCCATGAGCCAGGCCATCGTGCAGTGTATTGAGCGTTATGAACCCCGGATTTCGCACGCGGAGGTCC
GGGCAATCCTGCCACAGGCCGCCAGCCCACAGGAGATAATTTTTCGTATCACCGCCTGGGTGACATTTAA
CGATATCGACGATGTGCTGGAGTTTGATATGGCACCGGACGGCAGTCAGCATTATCGGGTGGAGTAG