SecReT6
Protein ID: 563652585
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05175
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1109390..1110862 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDV5RZ77
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-185, Aligned region: 68..489
Protein Sequence: 490 a.a.     [Download]
>gi|563652585|ref|YP_008860646.1| EvpB family type VI secretion protein [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFVASLLQSTSPAEPVNKLAVDS
MIADIDARISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVLHVTKTELLEDFEFAPEITQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTTPDMKLLNYVSAVGAMAHAPFLSSVSPEFMGLKSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSATENPIKSFNYAENVSHSHEHYLWGNT
AWMLASNIADSFAKYRWAPNIIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITL
TMRKNSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASFELSLVGRLDK
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1110862-1109390 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGTCTTTACAGGAAGAAGAACTTGTTTCCACCCGCACTGAACAGGGAAGCCATGCCCCGTCGTTGCTTG
ATGAAATCATGGCACAAACCCGTATCCAGCCCGGCGCTGACGGTTATGATATTGCCCGTCAGGGCGTAAC
GGCTTTTGTTGCCAGCCTCCTGCAATCCACTTCACCTGCAGAACCCGTAAACAAACTGGCCGTGGACAGC
ATGATTGCGGACATCGACGCCCGTATCAGCCGTCAGATGGATGCTATTATTCACGCCCCTCAGTTTCAGC
AACTGGAGTCGTTCTGGCGTTCAATGAAAGCGCTGGTCGATCGCGTTGATTTTCGTGAGAATATTAAGGT
GCATGTCCTCCATGTCACCAAAACGGAATTGCTGGAAGATTTCGAGTTCGCGCCGGAGATTACCCAGTCC
GGCTTCTATAAGCATGTTTATTCCAGCGGGTTTGGGCAGTTTGGCGGCGAACCCATTGCGGCGGTGCTGG
GCGCATATGAGTTCAAAAATACCACGCCGGATATGAAGCTGCTGAACTATGTCAGCGCCGTCGGCGCAAT
GGCTCACGCGCCGTTCCTTTCTTCCGTGTCGCCGGAGTTTATGGGCCTGAAATCATGGACCGAGCTGCCC
AATATCAAGGATCTCTACGCCATTTTTGAAGGCCCGGCCTATACAAAATGGCGCGCCCTGCGTGATTCCG
AAGATTCCCGCTACCTGGGACTGACCGCGCCGCGTTTTCTGCTTCGCCAGCCCTATTCCGCGACCGAAAA
CCCGATTAAAAGCTTCAACTACGCCGAAAATGTCAGCCACAGCCACGAGCATTATTTGTGGGGCAATACC
GCCTGGATGCTGGCCAGTAATATAGCCGATTCGTTCGCGAAATACCGGTGGGCGCCCAATATTATCGGGC
CGCAGAGCGGCGGCGCAGTAAAAGATCTGCCGGTACATTTATATGAGTCAATGGGGCAGATTCAGGCCAA
GATCCCGACGGAGGTGTTGATCACCGACCGCCGTGAGTTCGAGCTGGCCGAAGAGGGGTTCATCACCCTG
ACCATGCGTAAAAACAGCGATAATGCGGCGTTTTTCTCGGCTAACAGCGTTCAGAAACCCAAGCATTTTC
CGGGCAAAGACGCCGAGACCAACTACAAGCTGGGTACGCAGTTGCCTTATCTGTTCATTATTAACCGCCT
CGCGCACTACATTAAGGTGCTGCAACGCGAGCAGCTTGGGTCGTGGAAAGAGAGAAGCGATCTGGAGCGG
GAGCTGAATATTTGGGTGCGCCAGTATGTCGCCGACCAGGAGAATCCGCCTGCTGATGTCCGCAGCCGTA
AGCCGCTGCGTGGCGCTAAAGTGGAGGTGCTGGATGTGGACGGCGAGCCGGGCTGGTATCAGGTGGCGAT
TTCCGCACGGCCCCACTTTAAATATATGGGCGCGTCGTTTGAATTGTCTTTAGTCGGACGGTTAGATAAG
TGA

Protein ID: 563652586
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05180
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1110911..1111123 [-]
Producthypothetical protein
NoteTssC
UniProt IDV5RZW2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.002, Aligned region: 36..68
Protein Sequence: 70 a.a.     [Download]
>gi|563652586|ref|YP_008860647.1| hypothetical protein Q786_05180 [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MGLREETSRTDDAITQAVIRLFISQTGDINTETLEVLVAALDQRIGCLMDEIIHINGYQQMKPHWRKVFH
 
Nucleotide Sequence: 213 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1111123-1110911 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGGGCTTGCGGGAAGAGACCTCCAGAACCGATGACGCAATAACGCAGGCAGTGATCCGGTTATTTATCA
GTCAGACAGGCGACATCAACACAGAAACACTGGAGGTATTGGTCGCGGCGCTTGACCAGAGGATCGGATG
TCTAATGGATGAAATCATCCATATCAACGGGTACCAGCAGATGAAGCCACACTGGCGAAAGGTGTTCCAC
TGA