SecReT6
Protein ID: 563652587
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05185
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1111153..1111656 [-]
Producthypothetical protein
NoteTssB
UniProt IDV5RZI2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.90E-54, Aligned region: 7..163
Protein Sequence: 167 a.a.     [Download]
>gi|563652587|ref|YP_008860648.1| hypothetical protein Q786_05185 [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSIDKHSFNSVMAE
ASISLNFAVPASLKDDAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKLLELREALTALKGPLGNLPAF
RAQLQALLENEESREQLLREISQAENQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|563651606|ref|NC_022991.1|:c1111656-1111153 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGAGCAAAGATTATAACGGCAGCGTGGCACCCAAAGAACGCATTAATATTTCTTATATTCCAAAAACGG
ACGGTGAGCCTTCTGAGGTGGAATTACCCCTTAATATGTTGATAGTGGGGGATACCGGAAACTCACAGGA
AACAGCGCCACTTGATGAACGCCAGATGGTTTCTATCGACAAACATTCATTCAATTCAGTGATGGCAGAA
GCGTCCATTAGCCTGAATTTTGCAGTTCCGGCATCATTGAAGGACGACGCAAAAGATGGCGATGAGATGA
ATATCTCGCTGGAAATCAAATCCCTGAACGATTTTTCTCCGGACAGTGTGGCAAAACAGGTGCCGGAGTT
GAACAAATTGCTGGAACTACGCGAAGCGCTGACAGCATTAAAAGGGCCGCTGGGTAATCTGCCTGCATTT
CGCGCCCAGCTTCAGGCATTGCTGGAAAATGAAGAATCCCGCGAACAGTTACTGCGGGAGATCAGCCAGG
CAGAAAACCAGTAA