SecReT6
Protein ID: 563652589
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05195
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1113026..1115167 [+]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDV5S0N6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-64, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 2.50E-27, Aligned region: 366..458
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 500..522
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 524..546
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 548..570
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 614..632
Protein Sequence: 713 a.a.     [Download]
>gi|563652589|ref|YP_008860650.1| type IV secretion protein Rhs [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MSTGLRFTLEVDGLPPDALVVESFHLSQSLSTLFSLDISLVSQQLLNIDFSQVLEQPAHLKIWQGTEIQR
RVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSILGTILQENGVTDWSPLFSEPH
PAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQSLVLCDTVRFLPEAFEIPWNPNTRTEVSTPC
VSQFRHSAQIRPSSVIGKDYTFKRPGWAGRFEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFTRWQMEGW
RNNAEVAQGKSRSPAIWPGRRIQLTEHPQASLNREWQVVSSDLHGSQPQAAAGRSGSGTSLENHFTVIPA
DRTWRPRPLPKPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHADNPPPGGLPGTKTQMTIRSKTYKGSGFNELMFDDATGK
ERVYIHAQKNMNTEVLHNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVNQIQNVGVNQVEKVGSNQVIK
VGTNQIETVGLLRALNVGVVYQTTVGAIMNTSVAMMQSSQVGLHKSLMVGMGYSVNVGNKVTFSVGKTRS
DNAGQTAIYSAGEHLELRCGKARLVMTKDGKIFLNGTKIDLEGAESVNGDALTINWNCGATETVPDAPKD
DSPEPKMPDMRKF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|563651606|ref|NC_022991.1|:1113026-1115167 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGTCAACAGGATTACGTTTCACACTGGAGGTGGACGGCCTGCCACCGGATGCGCTGGTCGTGGAGTCCT
TTCACCTGAGCCAGTCCCTTTCCACGTTATTTTCCCTCGATATCTCGCTGGTCAGCCAGCAGCTGCTTAA
TATTGACTTCTCCCAGGTACTGGAACAACCGGCGCACCTGAAAATCTGGCAGGGCACGGAGATACAGCGC
CGGGTGAACGGCATCGTGACCTGGTTTGAGCAGGGGGAAAACGACGGACACCAGATGCTGTACAGCATGA
AAGTTCGCCCGCCGGTGTGGCGCGCCGCGCTGCGCCAGAACTCGCGTATTTTCCAGAACGAAGACATAAA
AAGCATTCTCGGGACGATACTGCAGGAAAACGGCGTGACGGACTGGAGCCCGCTGTTCAGCGAGCCGCAT
CCGGCGCGGGAGTTCTGCGTGCAGTACAGCGAAACGGATTACGACTTTCTGGCGCGGATGGCGGCGGAGG
AAGGTATTTTCTTTTACGAGGAACATGCGCAGACCAGCGACGACCAGAGCCTGGTGCTGTGCGACACGGT
GCGTTTTCTGCCGGAAGCCTTTGAAATCCCATGGAACCCGAACACCCGCACCGAGGTGAGCACGCCGTGC
GTCAGCCAGTTCCGCCACAGCGCGCAAATCCGCCCCTCCTCCGTCATCGGCAAGGACTACACCTTCAAAC
GCCCCGGCTGGGCAGGCCGCTTTGAGCATCAGGGTGAACATCAGGATTACCAGCGCACGCAGTACGAGGT
GTTTGACTATCCGGGGCGCTTCAAGGACGGCCACGGTCAGAACTTCACCCGCTGGCAGATGGAGGGCTGG
CGTAATAATGCCGAAGTGGCGCAGGGGAAAAGCCGTTCGCCGGCGATATGGCCGGGACGGCGTATTCAGC
TGACGGAACACCCACAGGCGAGCCTGAACCGGGAATGGCAGGTGGTGAGCAGTGATTTACACGGCAGCCA
GCCGCAGGCGGCGGCGGGGCGTTCAGGCTCCGGGACGAGCCTTGAAAACCATTTTACGGTCATTCCGGCG
GACAGGACATGGCGGCCACGCCCGCTGCCCAAACCGTCAGTGGACGGCCCGCAGTCGGCAGTGGTCACCG
GCCCGGAAGGGGAAGAAATCTTCTGCGACGAACATGGGCGGGTACGGGTGAAATTTAACTGGGACCGGTA
TAACCCGGCGAACCAGGACAGCTCGTGCTGGATACGGGTGGTACAGGCGTGGGCGGGGCCGGGGTTCGGC
AACCTGGCGATACCGCGGGTGGGGCAGGAAGTGATAGTGGACTTCCTCAACGGCGACCCGGACCAGCCGA
TAATCATGGGCAGGACGTACCACGCGGATAACCCACCGCCGGGGGGGCTGCCGGGCACCAAAACGCAGAT
GACCATCCGCTCGAAAACCTATAAAGGCAGCGGGTTTAACGAACTCATGTTCGATGATGCGACAGGGAAG
GAGCGGGTGTATATCCACGCGCAGAAGAACATGAATACCGAGGTGCTGCACAACCGCACCACCGATGTGA
CGAATAACCATGCTGAAACCATTGGCAATAACCAGGTGATCGCTGTCACCAATAACCAGATACAGACCAT
CGGCGTCAACCAGATCCAGAACGTTGGCGTCAACCAGGTGGAGAAAGTGGGCAGCAATCAGGTGATCAAG
GTGGGGACAAACCAGATTGAAACGGTGGGACTCCTCCGCGCCCTGAATGTGGGCGTGGTGTACCAGACTA
CGGTGGGCGCCATTATGAACACCTCAGTGGCCATGATGCAGTCTTCACAGGTGGGCCTGCATAAATCGCT
GATGGTGGGGATGGGGTACAGCGTTAATGTGGGGAACAAAGTCACCTTCTCGGTGGGGAAAACAAGGTCA
GACAATGCCGGGCAGACAGCGATTTATTCTGCGGGTGAACATCTGGAGCTTCGCTGCGGTAAAGCCCGGC
TGGTAATGACGAAGGACGGAAAAATTTTCCTTAACGGAACGAAAATTGATCTGGAAGGTGCGGAAAGCGT
CAATGGTGATGCGCTGACGATCAACTGGAACTGCGGCGCAACAGAAACCGTGCCGGATGCGCCGAAGGAT
GACTCGCCGGAGCCGAAGATGCCGGATATGAGGAAGTTCTGA