SecReT6
Protein ID: 563652590
SecReT6 ID876
T6SS typei1
Gene symbol-
Locus tagQ786_05200
StrainSalmonella enterica subsp. enterica serovar Agona str. 24249
Repliconchromosome [GenBank: NC_022991] [Browse all T6SS(s) in this replicon]
Location [Strand]1115236..1119402 [+]
Producttype IV secretion protein Rhs
NotePAAR
UniProt IDV5RZ83
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 235..246
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 318..340
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 359..393
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 413..438
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 423..461
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 447..481
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 487..524
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 531..566
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 573..609
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 615..650
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 656..689
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 688..707
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 697..727
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 718..751
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 863..894
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 943..987
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 992..1006
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 1031..1050
RHS_repeat [PF05593], Evalue: 6.70E-59, Aligned region: 1158..1187
RHS [PF03527], Evalue: 7.10E-18, Aligned region: 613..622
RHS [PF03527], Evalue: 7.10E-18, Aligned region: 643..649
RHS [PF03527], Evalue: 7.10E-18, Aligned region: 942..952
RHS [PF03527], Evalue: 7.10E-18, Aligned region: 1150..1189
Protein Sequence: 1388 a.a.     [Download]
>gi|563652590|ref|YP_008860651.1| type IV secretion protein Rhs [Salmonella enterica subsp. enterica serovar Agona str. 24249]
MSGKPAARMGDMTKYGGPIVQGSAGVLIGAPTGVSCSVCPNSPIEEVKGHPVNPLLGAKVLPGETDFALP
GPLAFILSRAYSSYRTKTPAPSGLFGPGWKMAADMRLQICERALILNDNGGRSIHFEPLSPGESSYSRSE
SFWLARCGVLMPDKSNPLHDLWQALPEEIRLSPNTYLATNSMQGPWWVLGWPERVPGADEALPAPLPPYR
VLTGLADSYGRTLTYHRAAEGELSGNVTGVTDGAGRRFQLVLTTQAQRAEAARGAGSAAPAYPETLPATE
YGTDNGIRLSQVWLTHEPDAEGDQEPAMLSRYEYTPGGELAAVYDRGGMEVRRFLYDADHPGRMTGHRYA
GRPQMRYRYNRDGQVEEQLNPEGLSYRYAYEKNRVTITDSLGRREVLHTEGEGGLKRVVMKESADGSVTR
SEYDPAGRLKAQTDAAGRRTEYSLHMASGMVTSVTGPDGRTVRYGHNSQRQLTSTTYPDGLRSTQEYDNK
GRLTAETSRTGETTRYSYDNPQSELPTGIQDATGSSKSVAWNRYGQMVAFTDCSGYETKYEYDRFGQMTA
VHREEGQSIYRSYNRRGLLVSQKDGQGRETQYDYNDAGDLITVTGPDGNRTETQYDGWGKAVATTQGGLT
RRMEYDAAGRVTQLTNENGSHSAFTWDTLDRLTQQTGFDGRVQRYGYDVTGKLTQSEDEDLVTHWHYDDS
DRLTHRTINGEEAERWQYNEQGWLTELSHLSEGQRVAVHYGYDNKGRLIRERQTVNDPETGTLLWEHETL
QGYSEQGLANRFKPDNLPPVEWLTYGSGYLAGMKLGDMPLVEYTRDRLHREVLRRFGSDTLPESYELTTT
YTPGGQFHSQHLTLPQLDREYGYDEGGRLVRISGPQQTREYRYSESGRLTGVHTSAENLDITLPYATDPA
GNRLPDPEFYPDSASTVWADNRITEDMQYLYRYDKYGRLTEKTDRIPEGVVIRMNDERTHRYEYDNQHRL
VHYVRTQHGETQAEGRYVYDPLGRRVGKGVWRRELVHWSDTRMELSRRPYVTWYGWEGDRLTTIQTGQSR
VQTVYAPGSFTPLVRIETDNAELEKTQHRSLAEKLSQEGSEDGQAVQLPAALTAMLDRLEGELRRNAVSE
ESRAWLAGCGLTPEQMAGQLEPEYTPQRKIHLYHCDQRGLPLALITPDNTVAWRAEYDEWGNLSGEENPA
DLEQVIRLPGQQYDEESGLYYNRHRYYNPGQGRYITQDPIGLKGGLNLYQYPLNPILNIDPLGLSGWDSL
GYGGFREICQQAGSAVHYLTPQEAAGVIHNMETMHNVYNPLSKYVFGISVGSTITGIAGTSFGVATVAEK
GSACIKDVVKSVIKDGERDPTNLALTCGKSFINEGGSSFQGKVSDYLIDALFSYKAKQ
 
Nucleotide Sequence: 4167 bp     [Download]
>gi|563651606|ref|NC_022991.1|:1115236-1119402 Salmonella enterica subsp. enterica serovar Agona str. 24249, complete genome
ATGAGCGGAAAACCGGCGGCCCGGATGGGCGATATGACGAAATACGGAGGCCCGATTGTCCAGGGGTCGG
CAGGGGTGCTGATAGGCGCGCCGACGGGCGTGTCGTGCTCGGTGTGTCCTAACAGCCCGATAGAAGAGGT
GAAAGGTCATCCGGTAAACCCGCTGCTGGGAGCAAAGGTACTACCCGGTGAGACGGATTTTGCGCTGCCC
GGCCCGCTGGCGTTCATCCTTAGCCGCGCCTACAGCAGTTACCGGACGAAGACGCCCGCGCCATCGGGGC
TGTTCGGTCCTGGCTGGAAGATGGCTGCCGATATGCGCTTACAGATTTGTGAGCGGGCGCTGATACTGAA
CGACAACGGAGGCCGGAGCATTCACTTTGAGCCACTGTCGCCGGGTGAGTCGTCATACAGTCGCAGCGAG
TCGTTCTGGCTGGCGCGGTGCGGGGTGCTTATGCCGGATAAAAGCAACCCGCTGCATGACCTCTGGCAGG
CACTGCCGGAAGAGATACGGTTAAGCCCGAACACGTACCTGGCAACAAACAGTATGCAGGGGCCGTGGTG
GGTGCTGGGGTGGCCTGAGCGGGTGCCGGGCGCGGATGAGGCGTTGCCCGCGCCGCTGCCGCCGTACCGT
GTGCTGACGGGGCTGGCGGACAGCTATGGACGGACGCTGACGTATCACCGCGCCGCAGAGGGTGAACTGT
CCGGGAATGTCACCGGGGTGACGGACGGTGCGGGACGGCGCTTTCAGCTGGTGCTGACCACGCAGGCGCA
GCGTGCGGAGGCGGCACGCGGGGCGGGTTCCGCCGCACCGGCATACCCTGAGACGCTGCCCGCCACGGAG
TACGGCACGGATAACGGTATTCGCCTCTCGCAGGTATGGCTGACGCATGAGCCGGACGCTGAGGGCGACC
AGGAGCCGGCAATGCTGTCGCGCTATGAGTACACGCCGGGCGGAGAGCTTGCCGCCGTGTACGACCGTGG
GGGCATGGAGGTGCGCCGCTTCCTGTATGACGCGGACCATCCGGGGCGGATGACGGGCCACCGGTATGCA
GGCAGGCCGCAGATGCGCTACCGCTATAACCGTGATGGTCAGGTGGAAGAGCAGCTTAACCCGGAAGGCT
TAAGCTACCGCTATGCGTATGAGAAAAACCGCGTCACCATCACGGACAGCCTGGGGCGGCGTGAGGTGCT
GCACACGGAAGGTGAAGGCGGGCTGAAACGGGTGGTGATGAAGGAATCCGCCGACGGCAGCGTGACGCGC
AGCGAGTACGACCCGGCGGGGAGGCTGAAAGCGCAGACGGACGCGGCGGGGAGAAGGACGGAGTACAGCC
TGCACATGGCGTCGGGGATGGTGACGTCGGTGACGGGGCCGGACGGGAGGACAGTACGCTATGGCCATAA
CAGCCAGCGGCAGTTAACGTCCACGACGTACCCGGACGGGCTGCGAAGCACGCAGGAGTATGATAATAAA
GGCAGGCTGACGGCGGAGACATCGCGTACCGGTGAGACGACGCGGTACAGCTATGATAATCCGCAGAGTG
AATTACCGACAGGGATACAGGACGCCACCGGCAGCAGTAAGTCAGTGGCCTGGAATCGCTACGGGCAGAT
GGTGGCGTTCACGGACTGTTCGGGGTATGAGACGAAGTATGAATATGACCGGTTCGGCCAGATGACGGCG
GTACACCGGGAGGAAGGGCAGAGCATCTACCGCAGCTATAACCGCCGTGGCCTTCTGGTCTCGCAGAAAG
ATGGTCAGGGCCGCGAAACGCAATACGATTATAACGATGCAGGCGACCTTATCACTGTGACCGGCCCGGA
CGGAAACCGCACTGAAACGCAGTACGACGGGTGGGGAAAGGCTGTTGCCACCACGCAGGGCGGGCTGACG
CGGCGGATGGAATATGATGCTGCTGGCCGTGTGACGCAACTGACCAACGAGAACGGCAGCCACAGCGCAT
TTACCTGGGATACGCTGGACCGCCTCACACAACAGACGGGCTTTGACGGACGGGTACAGCGGTACGGTTA
TGACGTGACGGGAAAACTCACACAGAGTGAAGATGAGGACCTGGTCACGCACTGGCACTACGATGACTCA
GATCGCCTGACGCACCGCACCATCAACGGAGAGGAAGCCGAGCGGTGGCAGTATAACGAACAGGGCTGGC
TGACGGAGCTGAGTCATCTCAGCGAAGGGCAGCGGGTGGCGGTGCATTACGGCTACGATAATAAAGGCCG
TCTTATCCGCGAGCGGCAGACGGTGAATGACCCGGAAACGGGGACATTGCTGTGGGAGCATGAGACGTTA
CAGGGGTACAGTGAGCAGGGGCTGGCAAACCGGTTTAAGCCGGATAACCTGCCGCCGGTGGAGTGGCTGA
CGTACGGGAGCGGTTATCTGGCGGGAATGAAGCTGGGGGACATGCCGCTGGTGGAGTACACGCGTGACAG
GCTGCACCGCGAGGTGTTGCGGCGGTTCGGTTCAGACACCCTCCCGGAGAGTTATGAACTGACGACCACA
TACACACCGGGCGGTCAGTTTCATAGCCAGCACCTGACGCTGCCGCAACTTGACCGGGAGTACGGTTACG
ATGAGGGCGGCAGACTGGTGCGCATCAGCGGACCGCAGCAGACGAGGGAGTACCGCTACAGCGAGAGCGG
ACGCCTGACCGGGGTGCATACCAGCGCCGAGAATCTGGACATTACCCTTCCGTATGCCACGGACCCGGCG
GGAAACCGGCTGCCGGACCCGGAGTTTTATCCCGACAGCGCCAGTACGGTATGGGCGGATAACCGCATCA
CGGAAGATATGCAGTACCTGTACCGCTACGACAAATACGGCAGGCTGACGGAGAAAACGGACCGTATCCC
GGAAGGAGTGGTTATCCGGATGAACGACGAACGTACACACCGGTACGAATACGATAACCAGCACCGTCTG
GTGCATTATGTGCGGACACAGCACGGAGAAACGCAGGCGGAGGGGCGGTATGTGTATGACCCGCTGGGCC
GCCGTGTGGGTAAGGGGGTGTGGAGGCGGGAGCTGGTTCACTGGAGCGACACGAGGATGGAGCTGTCGCG
CAGGCCGTATGTGACGTGGTACGGCTGGGAGGGGGACAGGCTGACGACCATCCAGACCGGACAGAGCCGT
GTCCAGACGGTGTATGCGCCGGGGAGTTTCACGCCGCTGGTGCGTATCGAAACGGATAATGCGGAGCTTG
AGAAAACGCAGCACCGCAGCCTGGCGGAGAAGCTGTCACAGGAGGGAAGTGAGGACGGCCAGGCGGTACA
GCTTCCGGCGGCGCTGACGGCGATGCTGGACAGGCTGGAGGGTGAGCTGAGGCGTAACGCGGTAAGTGAA
GAGAGCCGGGCGTGGCTGGCGGGATGCGGGCTGACGCCGGAGCAGATGGCGGGACAACTGGAGCCGGAGT
ACACCCCTCAAAGGAAAATCCATCTTTACCACTGCGACCAGCGTGGCCTGCCGCTGGCGCTGATTACCCC
GGACAACACGGTGGCATGGCGTGCGGAGTATGATGAATGGGGAAACCTGTCGGGCGAGGAAAATCCGGCG
GACCTGGAGCAGGTGATACGGCTGCCGGGGCAGCAATATGATGAGGAATCGGGGCTGTATTATAACAGGC
ACCGGTATTACAATCCGGGACAGGGAAGGTATATCACGCAGGATCCGATTGGGCTGAAAGGGGGGCTGAA
CCTGTATCAGTATCCGCTGAATCCGATTTTGAATATAGATCCTTTAGGATTATCAGGTTGGGATTCTCTT
GGATATGGAGGATTTAGGGAAATATGCCAGCAAGCTGGTTCGGCAGTACATTATCTAACACCACAAGAAG
CAGCAGGAGTGATACATAATATGGAAACTATGCATAACGTATACAATCCGTTATCTAAATATGTTTTCGG
GATATCAGTAGGTTCAACTATAACTGGTATAGCTGGTACGAGTTTCGGAGTGGCAACTGTTGCAGAAAAA
GGTTCTGCATGTATTAAGGATGTAGTTAAGTCCGTGATAAAAGACGGAGAAAGAGATCCAACAAATTTGG
CATTAACTTGCGGAAAAAGCTTTATAAATGAAGGTGGTTCCAGTTTTCAGGGTAAGGTATCCGATTACCT
TATTGACGCTCTTTTTTCCTATAAGGCGAAACAGTAA