SecReT6
Protein ID: 56414585
SecReT6 ID79
T6SS typei3
Gene symbol-
Locus tagSPA2471
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
Repliconchromosome [GenBank: NC_006511] [Browse all T6SS(s) in this replicon]
Location [Strand]2574363..2576609 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ5PFA1
KEGG IDspt:SPA2471
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.20E-80, Aligned region: 125..433
Phage_GPD [PF05954], Evalue: 5.20E-80, Aligned region: 637..651
Phage_base_V [PF04717], Evalue: 9.60E-26, Aligned region: 471..563
Protein Sequence: 748 a.a.     [Download]
>gi|56414585|ref|YP_151660.1| hypothetical protein SPA2471 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]
MSFVSTGNKTVGSDRPAITTPPIVGENKGVSSDAVVASVTDAAEQMAEQAVESLFGDLPEPSGLVKAAVA
AAQATAVAAGISDIAGAAQDVMSSLISGPGVHNVTVSGSAVPPQMLLFASLNGSEALGTLFTYVVQLKTP
DTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTH
TSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSED
SHTLVLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVAN
PRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQE
YLLMQTLLFVQDNAQHSGQNQHFTFSTRFELHPTREVYRPQRTISKPHTKGPQSAIVTGPAGQEIWTDQY
GRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTM
PPWGLPGAATQSGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQ
SEIATIGAVRDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNITA
TDADGQINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFPPKE
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|56412276|ref|NC_006511.1|:c2576609-2574363 Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 chromosome, complete genome
ATGAGTTTTGTATCCACGGGTAATAAAACTGTCGGGAGCGATCGGCCAGCTATCACTACGCCGCCAATTG
TCGGAGAAAATAAGGGTGTTAGTTCAGATGCCGTCGTAGCCAGTGTTACTGACGCAGCCGAACAAATGGC
AGAACAGGCAGTGGAATCGTTGTTTGGCGACTTACCGGAACCATCAGGACTGGTAAAAGCAGCAGTGGCA
GCAGCGCAGGCTACCGCTGTGGCGGCAGGGATATCGGATATAGCTGGTGCCGCACAGGACGTAATGTCAT
CCCTTATCTCCGGACCGGGAGTGCATAACGTTACGGTAAGCGGCAGTGCCGTGCCGCCGCAGATGTTGTT
GTTTGCCAGCCTTAATGGCTCGGAAGCACTGGGAACCTTGTTTACTTATGTGGTACAGCTAAAAACGCCC
GACACCCTGAATCTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATC
TGTGCGTCAACATCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGT
GGTGGGCCATGAAGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGCTGAAACTGCTGACCCAT
ACCAGCGACTACAAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATC
CCTACCCGGTGGAAAAGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAAC
TGATTTTGATTTTCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGAC
AGCCACACGCTGGTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGT
GGCACCAGGAAGGGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGAC
TGGCCAGTGGGTGCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACCGTGGCAAAC
CCGCGTGAAACCGGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAG
GCGAGATGCTGACGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAA
TATCCGCACACTCATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACTGCCGAAGTCAATCAGGAA
TACCTGCTGATGCAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGAACCAGCACTTTA
CCTTTTCCACCCGTTTTGAACTGCACCCCACCCGCGAGGTGTACCGCCCGCAGCGAACCATCAGCAAACC
CCACACCAAAGGGCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTAC
GGGCGGGTAAAGGTACAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCCTGCTGGATAC
GCGTCAGCTACCCGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCT
GGTGGATTTCAAAAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATG
CCGCCGTGGGGACTGCCGGGCGCGGCAACACAGAGCGGGATATACAGCCACACTATCGGCGGCGGACCGA
CCAATGCCAACGCCCTGCGTTTTGAAGATAAACCCGGTAGTGAAGAGGTCTGGCTACATGCTGAAAAAGA
TCAGCGTATTGAAGTTAATAATAATGAAAGTCACTGGGTGGGGAATAATCGGGTTAAGGTCATTGATCAG
TCAGAAATAGCCACTATTGGTGCTGTCCGCGACCATAAAGTTCAGTATGACGATACCTCTCTGGCCGGAG
GAAATAAAACCATTCAGACGGTAAAAGAGTTATATCTGGCAGCGGGTGATTCTATTACTCTGAGTTGTGG
TGACACCGTTCTGTACATGAGCAGTAAGGGGGAATTTTACGTAACCTGTAAAACGTTCAATATTACTGCA
ACAGATGCCGATGGTCAGATTAATACTATAAAAGGGCAGCTGGATTTAAATATGGATAAAAGAGAACCCA
AAGTGGGAACATTTGGTGAGTCAGAAAAAACAGCAATGGCAGCAGTAATTAAGGAAACTTTCCCACCCAA
AGAATAG