SecReT6
Protein ID: 56414606
SecReT6 ID79
T6SS typei3
Gene symbol-
Locus tagSPA2493
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
Repliconchromosome [GenBank: NC_006511] [Browse all T6SS(s) in this replicon]
Location [Strand]2594202..2594744 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ5PFD3
KEGG IDspt:SPA2493
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-58, Aligned region: 11..164
Protein Sequence: 180 a.a.     [Download]
>gi|56414606|ref|YP_151681.1| hypothetical protein SPA2493 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] [TssB]
MAINNSAQKFIARNRAPCVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|56412276|ref|NC_006511.1|:c2594744-2594202 Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150, complete sequence [TssB]
ATGGCTATCAACAATAGTGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGTGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGCTCTGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGTATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCCGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCG
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AATCGGCCGCTACCCAGCAAGATGTGTCAGCGGATAATGAATCAGCGGAATAA