SecReT6
Protein ID: 56414615
SecReT6 ID79
T6SS typei3
Gene symbol-
Locus tagSPA2503
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
Repliconchromosome [GenBank: NC_006511] [Browse all T6SS(s) in this replicon]
Location [Strand]2603319..2604362 [+]
Productcytoplasmic protein
NoteTssA
UniProt IDQ5PFC4
KEGG IDspt:SPA2503
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 47..106
ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 220..237
Protein Sequence: 347 a.a.     [Download]
>gi|56414615|ref|YP_151690.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]
MDMSLTKPVSAEQPCGPDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIRVLIL
LLRSRIQQAGAQGLAEMLMQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAALLDHEGVMAD
IRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVWAR
ETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISLPH
NAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLCQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|56412276|ref|NC_006511.1|:2603319-2604362 Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150 chromosome, complete genome
ATGGATATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACCTGCTGC
TGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCCGGAAGCCGTGAA
CTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGGGTGTTGATCCTG
CTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCATGCAACTGGCAGAAC
TGAGCGTAATCTGGTCTGATGCACTCCATCCGCAGCTGCTTACCGGCGAAGGCGCATCCGCAGAGTCTAT
TGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGCGTGATGGCAGAC
ATTCGCGGTATCACGCTGTCAAACAGTGCCGCCCTGCGCCTGCAGGTACGGGATGTCGAGCGCGCGTTAT
CCGCTCCCCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGACCTCGAAGCCCG
TGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTGTGGGCGCGT
GAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGCCTGACGTGG
TACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGGCACGGTTATGGA
TAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCCCTCCCACAC
AATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCATTCGTCGCTGGT
TTGAGAGCAGTGAACCCAGCAGCCCGACCATCCCACTGTTATGTCAGGCTGAAAGACTGGTGGGAAAACG
GTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAGTGA