SecReT6
Protein ID: 56479627
SecReT6 ID36
T6SS typeN/A
Gene symbol-
Locus tagSF0205
StrainShigella flexneri 2a str. 301
Repliconchromosome [GenBank: NC_004337] [Browse all T6SS(s) in this replicon]
Location [Strand]233555..234049 [-]
Productcytoplasmic protein
NoteTssE
UniProt IDQ83MB8
KEGG IDsfx:S0215, sfl:SF0205
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-21, Aligned region: 36..147
Protein Sequence: 164 a.a.     [Download]
>gi|56479627|ref|NP_706160.2| unnamed protein product [Shigella flexneri 2a str. 301]
MSASRQRPGNHLLPTLFDRLCDDAPNQKRDHGISVSPVQIKEIIRRDLSFLLNTVSHEDDIDAARYPYAA
ASVLNYGLPPLAGSFLYEHKWDDIRRAILRTITRFEPRLKASTLQIIPLQDERRQSGHNTLQFEIRGEIL
TQPYPTAFRVRSALDMEQSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|344915202|ref|NC_004337.2|:c234049-233555 Shigella flexneri 2a str. 301 chromosome, complete genome
GTGAGCGCTTCCCGCCAGCGTCCAGGCAATCACCTGCTGCCCACGCTGTTTGACCGCCTGTGTGACGACG
CCCCAAACCAGAAACGCGACCACGGTATCAGCGTCAGTCCGGTTCAGATTAAGGAGATCATCCGCCGGGA
TTTGTCATTTCTGCTCAACACCGTCAGCCATGAAGATGATATTGATGCTGCACGTTATCCGTACGCGGCA
GCGTCCGTACTTAACTACGGCCTGCCGCCACTGGCGGGCAGCTTTCTGTATGAGCACAAGTGGGACGATA
TCCGCAGGGCCATTTTGCGAACCATCACCCGGTTTGAACCCCGGCTGAAAGCGTCCACTCTGCAAATCAT
CCCACTTCAGGATGAGCGCCGCCAGAGTGGCCATAACACATTACAGTTTGAAATTCGCGGCGAGATCCTC
ACGCAGCCGTATCCGACTGCATTCCGGGTACGTAGCGCGCTGGATATGGAGCAGAGTCGCATTACGTTTT
TTTAA