SecReT6
Protein ID: 56479628
SecReT6 ID36
T6SS typeN/A
Gene symbolsat1
Locus tagSF0206
StrainShigella flexneri 2a str. 301
Repliconchromosome [GenBank: NC_004337] [Browse all T6SS(s) in this replicon]
Location [Strand]234244..234876 [-]
Productcytoplasmic protein
NoteTagJ
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.2e-26, Aligned region: 145..208
Protein Sequence: 210 a.a.     [Download]
>gi|56479628|ref|NP_706161.2| sat1 gene product [Shigella flexneri 2a str. 301]
MTNNNELPITLSALLRDYSVVEGIQMAEQQVRMHPAQASRRHSLFQLLCVAGDWSRALQQIQLCARMDAN
YTREAQVFGELIRCEIYRHACFQGEQRPGVILPPPAWMEDLLTALACNARGEAQEADAHRSRALEAITDT
SGQWNGGAFDWISDSDSRTGPVLELIAGGAYIWLPFSQICSLKSPRPAHLIDLIWKPVNVTLNNGDTHSA
 
Nucleotide Sequence: 633 bp     [Download]
>gi|344915202|ref|NC_004337.2|:c234876-234244 Shigella flexneri 2a str. 301 chromosome, complete genome
ATGACAAACAATAACGAGCTACCGATTACCTTGTCGGCGCTGCTGCGGGATTATTCCGTGGTGGAGGGCA
TTCAGATGGCAGAGCAACAGGTCAGGATGCACCCAGCGCAGGCCTCCCGCCGCCACAGCCTGTTTCAGTT
ATTGTGCGTGGCAGGCGACTGGTCGCGGGCACTGCAACAGATCCAGCTATGCGCCCGGATGGACGCAAAT
TATACTCGCGAAGCGCAGGTATTTGGCGAGCTGATCCGCTGTGAGATATACCGCCACGCCTGCTTTCAGG
GCGAACAGCGGCCCGGTGTTATTCTCCCGCCGCCCGCCTGGATGGAGGATCTGCTGACCGCCCTCGCCTG
TAACGCCCGTGGTGAAGCGCAGGAAGCTGATGCTCACCGCAGCCGCGCGCTTGAGGCCATAACAGACACT
TCCGGGCAGTGGAATGGCGGCGCATTTGACTGGATTAGCGACAGCGACTCCCGTACCGGTCCGGTACTCG
AACTGATCGCGGGCGGAGCATATATCTGGCTGCCGTTTTCACAAATCTGTTCGCTGAAATCGCCGCGGCC
TGCGCATCTGATCGATTTGATCTGGAAACCCGTCAACGTCACCCTGAACAATGGCGATACACACAGTGCC
TAG