SecReT6
Protein ID: 564949973
SecReT6 ID877
T6SS typei3
Gene symbol-
Locus tagU769_00420
StrainPseudomonas aeruginosa MTB-1
Repliconchromosome [GenBank: NC_023019] [Browse all T6SS(s) in this replicon]
Location [Strand]102326..103660 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDV5SPF7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-158, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|564949973|ref|YP_008882543.1| type VI secretion protein [Pseudomonas aeruginosa MTB-1]
MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGFSELKLDEALLTQGKLAIVSARGVLP
DGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPLKRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFES
RAPVALGSQAFRLLTERDGLGEYAAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLL
HQRGEALAGRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQ
RRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLIDNASFVLVVR
ADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPYHAGSTYFELDRGSAHWKQLTH
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|564949884|ref|NC_023019.1|:c103660-102326 Pseudomonas aeruginosa MTB-1, complete genome
ATGTCCTGGAATAACCGCGTGGTGTGGTCCGAAGGCATGTTCCTGCGGCCACAGCATTTCCAGCAGCACG
ACCGCTACCTGGAAACCCTGGTGGATGGCCGCTGCCGCTCGCTCCTGGCGGGCGGCTGGGGCTTTTCCGA
GCTGAAGCTGGACGAGGCCCTGCTGACCCAGGGCAAGCTGGCCATCGTCAGCGCCCGCGGCGTGCTGCCG
GATGGCACGCCGTTCAACATCCCCGCCGACGATCCGGCGCCGGCGCCGCTGAATGTCGAGGAAAGCCTGC
GCGATGGCATCGTCTACCTCGGCCTGCCGCTGAAGCGCGTCGGCACCCGCGACACGGTAGAGGAGGGCGA
GGCCCTCGGCGGCGCCCGCTACGTCAGCCAGGTGCAGGAAGTGCGCGACGACAATGCCGCCTTCGAGAGC
CGCGCCCCGGTGGCCCTGGGCAGCCAGGCGTTCCGCCTGCTGACCGAGCGCGACGGCCTCGGCGAATACG
CCGCGGTGGGCGTCGCGCGGGTCCGCGAGAAGCGCGCGGACCAGGCCCTGAGCCTGGACGAGGACTACCT
GCCGCCGGTACTCGACATTGCCGCCGCGCCGCCCCTGGCGTCCTTCGCCAAGGAGCTGCTGGGCCTGCTC
CACCAGCGCGGCGAAGCCCTCGCCGGGCGGGTGGTGGCCTCCAGCGCCGGGGGCGCCTCGGAAATCGCCG
ACTTCCTGCTGCTGCAACTGGTCAACCGCGCCGAGGCCCTCACCGGTCACCTGTCCCGCGTGCGCCCGCT
GCACCCGCAGGAGCTGTACCGCGAACTGGTGGCCCTGGCCGGCGAGTTCTGCACCTTCACCGCCAGCCAG
CGGCGTCCCGAGGAGTACCCGGTGTACAACCACGACGACCTGGCCGCCAGCTTCGCCCCGGTGATGCTCG
CCCTGCGCCAGGCGCTGGCGACGGTGATCGACGCCAAGGCGATCGCCATCCCGATCGTCGAGAAGGCCTA
CGGCGTGCACGTCGCGATGCTCAGCGACCGCAGCCTGATCGACAACGCCAGCTTCGTCCTGGTGGTGCGC
GCCGACGTCCCCGGCGAGAGCCTGCGCGGGCACTTCCCGCAGCAGGCCAAGGTCGGCTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAGCTGCCGGGTATCGGCCTGCTGCCGATGCCGGTGGCGCCGCGGCAGAT
CCCCTACCACGCCGGCTCCACCTATTTCGAACTGGACCGCGGCAGCGCGCATTGGAAGCAGCTGACGCAC
TCCGGCGGCTTCGCCTTCCACATCGCCGGCCAGTTCCCCGGGCTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA